Conserved Protein Domain Family
PHA03118

?
PHA03118: PHA03118 
multifunctional expression regulator; Provisional
Statistics
?
PSSM-Id: 165391
View PSSM: PHA03118
Aligned: 2 rows
Threshold Bit Score: 853.596
Threshold Setting Gi: 9625879
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
13242433   2 ETASTTSCDSDImACVCDDSMHLSPeDDPIDDFQLEVQNWAeesvpnsvqidDDEEAGEILTVTEETPNPADVCEDADRV 81 
9625879    1 MASASIPTDPDV-STICEDFMNLLP-DEPSDDFALEVTDWA-----------NDEAIGSTPGEDSTTSRTVYVERTADTA 67 
13242433  82 YtQPNFESKALS---GYHKDDEKCLVTFSDNIP----RRTNPIHVHYTNGERKSPKWYNQSYRKYQRRESWRYKHGRYSG 154
9625879   68 Y-NPRYSKRRHGrreSYHHNRPKTLVVVLPDSNhhggRDVETGYARIERGHRRSSRSYNTQSSRKHRDRSLSNRRRRPTT 146
13242433 155 RPDRSPSKHFRRTTDAEY-VRYNERRSRRDYIR---DISTDKLTEQARSTLKIAGLSISTNSVLEFTNVMKALIRRMTTf 230
9625879  147 PPAMTTGERNDQTHDESYrLRFSKRDARRERIRkeyDIPVDRITGRAIEVVSTAGASVTIDSVRHLDETIEKLVVRYAT- 225
13242433 231 ydedgnIEKHESWKDGGCYPTTEENISWAELMLYGHKLYQTFQTYRVSIKLGRALRERIIRGESLLEALESADELITWLK 310
9625879  226 ------IQEGDSWASGGCFPGIKQNTSWPELMLYGHELYRTFESYKMDSRIARALRERVIRGESLIEALESADELLTWIK 299
13242433 311 LMAAKNLPIWTWNPIVATSKSLVENLKLKLGPVMRCLLLRRDGGEElSTTFPELLHRQRFSDITCMPTFMFVVISRVVTA 390
9625879  300 MLAAKNLPIYTNNPIVATSKSLLENLKLKLGPFVRCLLLNRDNDLG-SRTLPELLRQQRFSDITCITTYMFVMIARIANI 378
13242433 391 VLRGDKCIAYEDISSSAQVLEEYTPGSCKAGVLESIITHGRYCGIPECRITCWPEFVPETHHHGKFFKCSYFEN 464
9625879  379 VVRGSKFVEYDDISCNVQVLQEYTPGSCLAGVLEALITHQRECGRVECTLSTWAGHLSDARPYGKYFKCSTFNC 452
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap