Conserved Protein Domain Family
PHA03115

?
PHA03115: PHA03115 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177532
View PSSM: PHA03115
Aligned: 5 rows
Threshold Bit Score: 597.74
Threshold Setting Gi: 20178570
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195381   1 MSRKFMQVYEYDREQYLDEFIEDRYNDSFITSPEYYSAEKYMCRYTILNHNCVNVRRCALDSKLLHDIITNCKIYNNIEL 80 
22164599    1 MSRKFMQVYEYDREQYLDEFIEDRYNDSFITSPEYYSAEKYMCRYTTLNHNCVNVRRCALDSKLLHDIITNCKIYNNIEL 80 
20178570    1 MSRKFMQVYEYDREQYLDEFIEDRYNDSFITSPEYYSAEKYMCRYTTLNHNCVNVRRCALDSKLLHDIITNCKIYNNIEL 80 
9627707     1 MSRKFMQVYEYDREQYLDEFIEDRYNDSFIASPEYYSAEKYMCRYTILNHNCVNVRRCALDSKLLHDIITNCKIYNNIEL 80 
66275995    1 MSRKFMQVYEYDREQYLDEFIEDRYNDSFITSPEYYSAEKYMCRYTTLNHNCINVRRCALDSKLLHDIITNCKIYNNIEL 80 
113195381  81 VRATKFVYYLDLIKCNWVSKVGDSVLYPVIFITHTSTRNLDKVSVKTYKGVKVKKLNRCADHAIVINPFVKFKLTLPNKT 160
22164599   81 VRATKFVYYLDLIKCNWVSKVGDSVLYPVIFITHTSTRNLDKVSVKTYKGVKVKKLNRCADHVIVINPFVKFKLTLPNKT 160
20178570   81 VRATKFVYYLDLIKCNWVSKVGDSVLYPVIFITHTSTRNLDKVSVKTYKGVKVKKLNRCADHAIVINPFVKFKLTLPNKT 160
9627707    81 VRATKFVYYLDLIKCNWVSKVGDSVLYPVIFITHTSTRNLDKVSVKTYKGVKVKKLNRCADHAIVINPFVKFKLTLPNKT 160
66275995   81 VRATKFVYYLDLIKCNWVSKVGDSVLYPVIFITHTSTRNLDKVSVKTYKGVKVKKLNRCADHAIVINPFVKFKLTLPNKT 160
113195381 161 SHAKVLVTFCKLRTDIMPIEAPCPGNVLVYTFPDINKRIPGYIHVNIEGCIDGMIYINSSKFTCVLKLHRSMYRIPPFPI 240
22164599  161 SHAKVLVTFCKLKTDITPVEAPLPGNVLVYTFPDINKRIPGYIHVNIEGCIDGMIYINSSKFMCILKLHRTVYRLPPFPI 240
20178570  161 SHAKVLVTFCKLRTDITPIEAPLSGNVLVYTFPDINKRIPGYIHLNIEGCIDGMIYINSSKFACILKLHRSMYRIPPFPI 240
9627707   161 SHAKVLVTFCKLRTDIMPIEAPYPGNVLVYTFPDIHKRIPGYIHINIEGCIDGIIYINSSKFSCVLKLHRSMYRIPPFPI 240
66275995  161 SHAKVLVTFCKLKTDITPVEAPLPGNVLVYTFPDINKRIPGYIHLNIEGCIDGMIYINSSKFACVLKLHRSMYRIPPFPI 240
113195381 241 DICSCCSQYTNDDIEILIHDLIKDVAIFKNKEMVYYLKLNNKTIARFTYFNNIDTAITQEHEYVKIALGIVCKLMINNMH 320
22164599  241 DVCSCCSQHTNDSIEVPIHDLIKDVTIFKNKETVYYLKLKNKTIARFTYFYNIDTAITQEHDYVKIVLGLFCKLMINTMH 320
20178570  241 DICSCCSQYINYDIEIPINDLIKDVTIFKNKEMVYYLKLNNKTIARFTYFNNIDTAITREHEYVKIALGIVCKLMINNMH 320
9627707   241 DICSCCSQYTNDDIEIPIHDLIKDVVIFKNKEMVYYLKLNNKTIARFTYFNNIDTAITQEHKYVKIALGIVCKLMINNMH 320
66275995  241 DICSCCSQYINYDIEIPIHDLIKDVAIFKNKETVYYLKLNNKTIARFTYFNNIDTAITQEHEYVKIALGIVCKLMINNMH 320
113195381 321 SIVGVNHSNTFVNCLLEDNV 340
22164599  321 SIVGVNHSNTFVNCLLDDNK 340
20178570  321 SIVGVNHSNTFVNCLLEDNV 340
9627707   321 SIVGVNHSNTFVNCLLEDNV 340
66275995  321 SIVGVNHSNTFVNCLLEDNV 340
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap