Conserved Protein Domain Family
PHA03108

?
PHA03108: PHA03108 
poly(A) polymerase small subunit; Provisional
Statistics
?
PSSM-Id: 165387
View PSSM: PHA03108
Aligned: 25 rows
Threshold Bit Score: 513.467
Threshold Setting Gi: 115531760
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556117    1 MNVIELSKPFIFYDELVHRLDYDKA-IECSCKAKFQGQGQLKLLLGELYFLNTLLRNNMLYSDmVIVYIGSAPGSHIKFL 79 
157939691   1 MDAVSMEKPIMYLDETNSEMDYDPN-SANEKNKKFPFQGQLKLLLGELFFLSKLQRHGILDGS-TVLYIGSAPGTHIRYL 78 
38229230    1 MDAVSMEKPIMYLDEIDNELKYDPN-SANEKNKKFPFQGQLKLLLGELFFLSKLQRHGILDGS-TVLYIGSAPGTHIRYL 78 
41057489    1 MEGVEMEKPLLYFDELTGERDFDAAfAEANEPAKLPAQGQLKLLVGELVFLNRLYRHGMLDGS-VIVYIGSAPGTHICCL 79 
41057116    1 MEGVEMDKPLLYFDEIAGAREYDAAfAEKHEPPKIPGRGQMKLLVCELVFLNRLHLHGMLDGS-VIVYVGSAPGRHICCL 79 
12085051   31 MDAVSMEKPIMYLDETNSEMDYDPN-SANEKNKKFPFQGQLKLLLGELFFLSKLQRHGILDGS-TVLYIGSAPGTHIRYL 108
9633874     1 MEPVSMDKPFMYFDEIEDELEYEPE-SVNETPKKLPHQGQLKLLLGELFFLSKLQRHGILDGS-TIVYIGSAPGTHIKYL 78 
9633701     1 MEPVSMDKPFMYFDEIDDELEYEPE-SVNETPKKLPHQGQLKLLLGELFFLSKLQRHGILDGS-TIVYIGSAPGTHIKYL 78 
9634804     9 FKELEMTKPYMFFNELVGEEDYNKE--LENSNTKFQGQGQLKLLLGELYFLNTLIKNKTLCSDtVIVYIGSAPGSHINFL 86 
9629008     1 MEAQAMERPLLYFHELTQTQEYDAE-VERAARSRFPAQGQLKLLIGELFFLNKLHRREMLAGT-TVVYIGSAPGGHIRYL 78 
40556117   80 YSHLESLGIRLKWILIDGRDHDSSLSTLRNVTIIKRFVDEQYLFKLHEKLKKE-KVILISDIRSLR-GKEPTSEDLLHDY 157
157939691  79 RDHFISMGLVIRWMLIDGRQHDIILNGLRDVSLITRFVDESYIKLLKKQLHNS-KIILISDIRSKRgGNEPSTEDLLANY 157
38229230   79 RDHFISMGLVIKWMLIDGRHHDIILNGLRDVSLITRFVDESYIKLLKKQLYPS-KIILISDIRSKRgGNEPSTEDLLSNY 157
41057489   80 HSHFQELGVSLKWILVDGRKHDACLMGLRNVTTVTRFADEAYLRELRAELKRA-KVVLISDIRSNRvNTEPTTADLLRDY 158
41057116   80 HSHFQELGVSLKWVLIDGRKHDPCLSGLRNVTTVTRFADEAYLRELRGELRRS-KIVLISDIRSNRvDTEPTTADLLRDY 158
12085051  109 RDHFISMGLVIRWMLIDGRQHDIILNGLRDVSLITRFVDESYIKLLKKQLHNS-KIILISDIRSKRgGNEPSTEDLLANY 187
9633874    79 RDHFVSMGLVIKWMLIDGRTHDTILEGLRDVILITKFVDEAYIRQLKKQLYPS-RVILISDVRSKRgKKEPTTQDLLSNY 157
9633701    79 RDHFMSMGLVIKWMLIDGRTHDPILEGLRDVILITKFVDEAYIRQLKKQLYPS-RVILISDVRSKRgQKEPTTQDLLSNY 157
9634804    87 YHYMDDLKIDLKWILIDGRDHDRSLESLKNVSIIHRFVDEQYLFKLRNMIRKNhKIVLISDIRSLR-GKEPTSEDLLHDY 165
9629008    79 VEHFRALGVPLRWMLLDGRSHDSRLQGLSDVTLVTRFVDERYLMRMRQALRGA-RVVLISDIRSRR-GSEPSTEDLLYDY 156
40556117  158 SLQNLMISILRPIASSLKWRCPFPDQWIRDFYIPLGDEFLQPFAPSYSAEMRLLGSYTRGPIRLIRITREAAVEYEKKMF 237
157939691 158 ALQNIMVSVLQPIASSLKWRCPFPDQWLRDFYIPYGNEMLQPFAPSYSAELRLITIYSGEPIKLRCITKNDAKKYEKKMF 237
38229230  158 ALQNIMVSVLQPVASSLKWRCPFPDQWLRDFYVPYGNEMLQPFAPLYSAELRLITIYSGEPIKLRCITINDAKKYEKKMF 237
41057489  159 ALQNVMVSVLKPIASSLKWRCPFPDSWEKDFYVPCGKEMLQPFAPPFSAEMRLLSVYADTPARLRLVTLSDAVKYEKRMF 238
41057116  159 ALQNTMVSVLKPVASSLKWRCPFPDSWEKDFYVPCGKEMLQPFAPPFSAEMRLLTVYSETRPKLRLITLSDAVNYEKRMF 238
12085051  188 ALQNIMVSVLQPIASSLKWRCPFPDQWLRDFYIPYGNEMLQPFAPAYSAELRLITIYSGEPIKLRCITKNDAKKYEKKMF 267
9633874   158 SLQNIMVSVLKPAASSLKWRCPFPDQWIKDFYVPHGNEMLQPFAPSYSAEMRLLSIYSGTPIRLKCITQQDSLKYEKKMY 237
9633701   158 SLQNIMVSVLKPAASSLKWRCPFPDQWIKDFYVPHGNEMLQPFAPSYSAEMRLLSIYSGTPIRLKCITQQDSSKYEKKMY 237
9634804   166 ALQNQMVSILKPIASSLKWRCPFPDQWIRDFYIPCGDEFLQPFAPPFSAEMRLLSCYSRAPIRLIRIDKNAAIEYEKKMF 245
9629008   157 ALQNSMLSILKPVASSLKWRCPFPDQWLHNFYVVCGKELLQPFAPPFSAELRLLSVHAGAP-RLRCITLAAARDYEKKMF 235
40556117  238 YLNNKVRKSIVLDFDYPRQEYDFFHMFYILKDLIVSesLEFTTDKQKVIFLQDSIFKSLNIKPTP 302
157939691 238 YINKVIRNKIILNFDYPNQEYDFFHMYFMLKTVYYN--KEFSSVKEKVLFFHQSIFRFLKIPIIN 300
38229230  238 YVNKVIRNKIILNFDYPNQEYDFFHMYFMLKTVYYN--KEFSSTKEKVLFFHQSIFKFLKIPIIN 300
41057489  239 YLNSVVRRRVILNFDYPNQEYDFFHMFYLLSSVVCS--KEFKSAKDKVLSLQQGFFRFLRIPAIS 301
41057116  239 YLNSVVRQRVILNFDYPNQEYDFFHMFCLLSSVVCS--CEFKSPKEKVLSLQNRFFRFLRIPPSI 301
12085051  268 YINKVIRNKIILNFDYPNQEYDFFHMYFMLKTVYYN--KEFSSVKEKVLFFHQSIFRFLKIPIIN 330
9633874   238 YLNKIIRNRIIINFDYSNQEYDFFHMYHMLKTVYSN--KSFTSNKSKVLHLHQSIFRFLKIPITN 300
9633701   238 YLNKIIRNRIIINFDYSNQEYDFFHMYHMLKTVYSN--KSFTSNKSKVLHFHQSIFRFLKIPITN 300
9634804   246 YLNTKIRPKIVLDFDYPNQKYDYFYMFYILKDIVLPtyKEFSTYKQKVIFLQEAIFNALNIKP-- 308
9629008   236 YLNNVIRRRIVLNFDYPNQEYDFFHMFHLLNTVLCP--RSFDSPTKKVLFLQQSIFRFLGIQSPL 298
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap