Conserved Protein Domain Family
PHA03099

?
PHA03099: PHA03099 
epidermal growth factor-like protein (EGF-like protein); Provisional
Statistics
?
PSSM-Id: 165381
View PSSM: PHA03099
Aligned: 7 rows
Threshold Bit Score: 252.251
Threshold Setting Gi: 17974919
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66276007    1 MSMKYLMLLFAAMIIRSFADSGNAIETTSPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRC 80 
113195188   1 MSMKYLMLLFAAMIIRSFADSGNAIETTSPEITNTTTDIPAIRLCGLEGDGYCLHGNCIHARDIDGMYCRCSHGYTGIRC 80 
66275806    1 MSMKYLMLLFAAMIIRSFADSGNAIETTSPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRC 80 
20178389    1 MSMKYLMLLFAAMIIRSFADSGNAIETTSPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCFHGYIGIRC 80 
18640244    1 MSMKYLMLLFATMIIRSFADSGNAIETTSPEITNTTTDIPAIRLCGPEGDGYCLHGDCIHARDINGMYCRCSHGYTGIRC 80 
17974919    1 MSIKYLMLLFAAMIIRSLADSGNAIETTSPEITNATTDIPAIRLCGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRC 80 
9627523     1 MSMKYLMLLFAAMIIRSFANSGNAIETTLSEITNTTTDIPAIRLCGPEGDRYCFHGICIHARDIDGMYCRCSHGYTGIRC 80 
66276007   81 QHVVLVDYQRSENPNTTTSYIPSPGIMLVLVGiiIITCCLLSVYRFTRRT-KLPIQDMVVP 140
113195188  81 QHVVLVDYQRSEKPNTTTSYIPSPGIVLVLVG--IIMCCLLSVYRFTLRTnKLPLQDMVVP 139
66275806   81 QHVVLVDYQRSENPNTTTSYIPSPGIMLVLVGiiIITCCLLSVYRFTRRT-KLPIQDMVVP 140
20178389   81 QHIVLVDYQRSEKPDTTTSYIPSPGIVLVLVGi-IITCCLLSVYRFTRRT-KLPLQDMVVP 139
18640244   81 QHVVLVDYQRSEKPNTTTSYIPSPGIVLVLVG--IIMCCLLSVYRFTRRTnKLPLQDMVVP 139
17974919   81 QHVVLVDYQRSGKPDTTTSYIPSLGIVLVLVGi-IITCCLLSVYRFTRRT-KLPIQDMVVL 139
9627523    81 QHVVLVDYQRSEKPNTTTSYIPSPGIVLVLLVs-IIVCCLLFVYRFTRRTnKLPLQDMVVP 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap