Conserved Protein Domain Family
PHA03094

?
PHA03094: PHA03094 
dUTPase; Provisional
Statistics
?
PSSM-Id: 165376
View PSSM: PHA03094
Aligned: 16 rows
Threshold Bit Score: 248.142
Threshold Setting Gi: 20178416
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956297   1 MSYLTVKCLKLSEFATIPKKATHNSAGYDLYSAYDYTVNPLDRILVRTDISLEIPECCYGRIAPRSGLALNYNIDIGGGV 80 
148912895   3 HSLSVVNCIRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYGIDIGGGV 82 
157939637   1 MSKFIVYVKKSSESATIPTKSSKKSAGYDLYSAYDYLVCPKNRLLVKTDICLSIPDGCYGRIAPRSGLSLNSCIDIGGGV 80 
18640099    1 -MSLYVKCVKLSNNAIIPNRSTSGSAGYDLYSAYSYTVKPYNRILVRTDICLMIPDKCYGRISPRSGLSLNYNIDIGGGV 79 
21492472    3 HSLSVVNCIRLSAFAKLPTKSTDFSAGYDLYSAYDYIVKSKERILVKTDISLSIPKKCYGRIAPRSGLSLYYGIDIGGGV 82 
18640271    5 NINSPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLK-GIDIGGGV 83 
12085000    1 MSKFIVYVKKSSESATIPTKSSKKSAGYDLYSAYDYLVCPKNRLLVKTDICLSIPDGCYGRIAPRSGLSLNSCIDIGGGV 80 
9627547     5 NINSPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIAPRSGLSLK-GIDIGGGV 83 
38229181    1 MSKFIVYVKKSSEFATIPTRSSKKSAGYDLYSAYDYLVRPKSRVLVKTDICLSIPDECYGRIASRSGLSLNNSIDIGGGV 80 
62637402    1 MSDITVKCLKLSEFATIPKKATYNSAGYDLYSAYDYTVNPFDRILVRTDISLEIPECCYGRIAPRSGLALNYNIDIGGGV 80 
211956297  81 IDRDYRGNIGVIVINNSTCVFEIKAGDRIAQIIFERIENPSIEEVLELKDTFRGNRGFGSSGLN 144
148912895  83 IDEDYRGNIGVIFINNSKNTFNIKRGDRVAQIIFEKVEYPKIKEVKCLDGTNRDNNGFGSSGIL 146
157939637  81 IDSDYRGIIGVIFINNGNSPYYIKKGDRIAQIVFEKLANVDLKEITNLDCTCRGDSGFGSSGV- 143
18640099   80 IDSDYRGEIGIVFINNGCSDFNIKVGDRIAQIIFERVEYPIMEEVKCLEDTERGNSGFGSSGM- 142
21492472   83 IDEDYRGNIGVIFINNGKNTFNIKRGDRVAQIIFEKVEYPKIKEVKCLDGTNRDNNGFGSSGIL 146
18640271   84 IDEDYRGNIGVILINNGKCTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQGFGSTGLR 147
12085000   81 IDSDYRGIIGVIFINNGNSPYYIKKGDRIAQIVFEKLANVDLKEITNLDCTCRGDSGFGSSGV- 143
9627547    84 IDEDYRGNIGVILINNGKYTFNVNTGDRIAQLIYQRIYYPELKEVQSLDSTDRGDQGFGSTGLR 147
38229181   81 IDGDYRGVIGVIFINNGNSPHYIKRGDRIAQIVFERLANVEIKEISNLDCTCRGDCGFGSSGI- 143
62637402   81 IDRDYRGNIGVIVINNSTCVFEIKTGDRIAQIIFERIENPSIEEVLELKDTFRGNRGFGSSGLN 144
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap