Conserved Protein Domain Family
PHA03092

?
PHA03092: PHA03092 
semaphorin-like protein; Provisional
Statistics
?
PSSM-Id: 165374
View PSSM: PHA03092
Aligned: 7 rows
Threshold Bit Score: 196.719
Threshold Setting Gi: 22164745
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195341   1 MIPLLFILFYFANGIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNKLNKTGLA-NTNYITTSIKVEd--eDTLVC 77 
22164745    1 MIPLLFILFYFTNCIEWHKFETSEEIISTYLIDDVLYTGVNGAVYTFSNNELNKTGLTnNNNYITTSIKVE----DTLVC 76 
20178538    1 MIPLLFILFYFANGIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNELNKTGLT-NNNYITTSIKVEd--kDTLVC 77 
9627669     1 MIPLLFILFYFANGIEWHKFETSEKIISTYLIDDVLYTGVNGAVYTFSNNKLNKTGLA-NTNYITTSIKVEdvih----- 74 
9627671       --------------------------------------------------------------------------------    
66275960   39 MIPLLFILFYFANGIEWHKFETSEEIISTYLLDDVLYTGVNGAVYTFSNNKLNKTGLA-NTNYITTSIKVEdadkDTLVC 117
66275961      --------------------------------------------------------------------------------    
113195341  78 GTNNGNPKCWKIDGS----------------------------------------------------------------- 92 
22164745   77 GTNNGNPKCWKIDGSedpkyrgrgyapyqnskvtiishnecvlsdiniskegikrwrrfdgpcgydlytadnvipkdgvr 156
20178538   78 GTNNGNPKCWKIDGSedpkhrgrgyapyqkskvtiisyngcvlsdiniskegikrwrrfdgpcgydlytadnvipkdgvr 157
9627669       --------------------------------------------------------------------------------    
9627671       --------------------------------------------------------------------------------    
66275960  118 GTNNGNPKCWKIDGSddpkhrgrgyapyqnskvtiishngcvlsdiniskegikrwrrfdgpcgydlytadnvipkdglr 197
66275961      --------------------------------------------------------------------------------    
113195341     --------------------------------------------------------------------------------    
22164745  157 gafvdkdgtydkvyilftdtidtkrivkipyiaqmclndeggpsslsshrwstflkvelecdidgrsyrqiihskaiktd 236
20178538  158 gafvdkdgtydkvyilftdtigskrivkipyiaqmclndeggpsslsshrwstflkvelecdidgrsyrqiihsktiktd 237
9627669       --------------------------------------------------------------------------------    
9627671       --------------------------------------------------------------------------------    
66275960  198 gafv---------------------------------------------------------------------------- 201
66275961      --------------------------------------------------------------------------------    
113195341  93 ----------------------DKTIKDAYI------------------------------------------------- 101
22164745  237 ndtilyvffdspysksalctysMNAIKHSFStsklggytkqlpspapgiclpagkvvphttfdiie-qynelddiikpls 315
20178538  238 ndtilyvffdspysksalcaysMNSIKQSFTtsklegytkqlpspapgiclpagkvvphttfeviekynvlddiikplsn 317
9627669       --------------------------------------------------------------------------------    
9627671     1 ----------------------MNTIKQSFStsnwediqsnyclqllvyvyqlekvvphntfdvieqynvldniikplfn 58 
66275960  202 -------------------------------------------------------dkdgtydkvyilftdtigskrivki 226
66275961    1 ----------------------MNTIKQSFStsklegytkqlpspapgiclpagkvvphttfeviekynvlddiikplsn 58 
113195341 102 ---------------------REDCPTYWISIINVYIYLLIKKPGRKDVMHAKL 134
22164745  316 qpifegpsgvkwfdikekeneHREYRIYFIKENTIYSFDTKSKQTRSAQVDARL 369
20178538  318 qpifegpsgvkwfdikekeneHREYRIYFIKENTIYSFDTKSKQTRSAQVDARL 371
9627669       ------------------------------------------------------    
9627671    59 qpifkgpsdvkwfdikekeneHRKYRIYFIKENTIYSFNTKSKQTRSSQVDAQL 112
66275960  227 pyiaqmclndeggpsslsshrwstflkvelecdidgrsyrqiihSRTIKTDNDT 280
66275961   59 qpifegpsgvkwfdikekeneHREYRIYFIKENSIYSFDTKSKQTRSSQVDARL 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap