Conserved Protein Domain Family
PHA03079

?
PHA03079: PHA03079 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165366
View PSSM: PHA03079
Aligned: 7 rows
Threshold Bit Score: 81.492
Threshold Setting Gi: 30844344
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30844344   1 MEVIADRLDDIVEQNIADEKFVDFVIHGlLEHQCPSILRPLLRLLIDILLFVIVIYIFTVRLVRRNYQMLLVLVALVIAL 80 
113195269  1 MEVIADRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTVRLVSRNYQMLLALVVLVITL 79 
17974994   1 MEVIADRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTVRLVSRNYQMLLVLVALVITL 79 
18640321   1 MEVIADRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTIRLVSRNYQMLLVLVALVITL 79 
22164678   1 MEVIADRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTVHLVRRNYQMLLALVAQVITL 79 
9627595    1 MEVIADRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTVRLVSRNYQMLLALLALVISL 79 
66275886   1 MEVITDRLDDIVKQNIADEKFVDFVIHG-LEHQCPAILRPLIRLFIDILLFVIVIYIFTVRLVSRNYQMLLALVALVITL 79 
30844344  81 TIFYYFIL 88 
113195269 80 TIFLLLYT 87 
17974994  80 TIFLLLYT 87 
18640321  80 TIFYYFIL 87 
22164678  80 TIFYYFIL 87 
9627595   80 TIFYYFIL 87 
66275886  80 TIFYYFIL 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap