Conserved Protein Domain Family
PHA03075

?
PHA03075: PHA03075 
glutaredoxin-like protein; Provisional
Statistics
?
PSSM-Id: 177519
View PSSM: PHA03075
Aligned: 24 rows
Threshold Bit Score: 177.941
Threshold Setting Gi: 9634747
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634747     1 MKGTIILFGKPNCPLCKFSNEILsnKKIASKYEIVRINIATFFDKSKVVEILGMDKSYDLLNSIGEKLGNEYVLVFRYDD 80 
113195261   1 MKNVLIIFGKPYCSICENVSEAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
17974986    1 MKNVLIIFGKPYCSICENVSEAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
18640313    1 MKNVLIIFGKPYCSICENVSEAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
22164670    1 MKNVLIIFGKPYCSICENVSEAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
9627587     1 MKNVLIIFGKPYCSICENVSEAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
9628991     1 MKDVLLLLGKPLCPVCALANTIL--SHLEDKYPILRVNILSLFTKKNVVDVLGM-RTYELVSALMEFFGGEYVMVLKMQP 77 
66275878    1 MKNVLIIFGKPYCSICENVSDAV--EELKSEYDILHVDILSFFLKDGDSSMLGDVKRGTLIGNFAAHLSNYIVSIFKYNP 78 
41057476    9 AKPTLILLGKPLCSVCEVTSRML--AALESEFDLKRVNILSLFAKDGAVTVLGM-GVYRLITEITEYFGNEYVLLLKYDA 85 
40556042    1 MKETIILFGKPACSLCKISSDILtnKKISDKYTVVRVNILSFFKDPKVVEVLGMNKFYELINTIGKKLGNEYVLLFKYDE 80 
9634747    81 TSKQMAYIPFKKYIVIGQISQDSIDFDKLLNELETTPYNILLKDK 125
113195261  79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKANYGVWPPVT 123
17974986   79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWPPVT 123
18640313   79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKANYGVWPPVT 123
22164670   79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWPPVT 123
9627587    79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKANYGVWPPVT 123
9628991    78 DTGEVAFVPFKEYLVVGQISMDALDYDQLERSVEDAPYGVWPPRK 122
66275878   79 QTKQMAFVDINKSLDFTKTDKSLVNLEILKSEIEKATYGVWPPVT 123
41057476   86 ALKAMAAVDIRQFVVVAQIDEKKVDLDQLREAILSAKFNVWPVAA 130
40556042   81 DSGQMAHVPFRKYVVIANMSYDAIDYDQLLKDIESSRYNELITAE 125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap