Conserved Protein Domain Family
PHA03074

?
PHA03074: PHA03074 
late transcription factor VLTF-3; Provisional
Statistics
?
PSSM-Id: 165363
View PSSM: PHA03074
Aligned: 27 rows
Threshold Bit Score: 234.641
Threshold Setting Gi: 9964519
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21492545    2 NLNLKMCSGCFHNGIVSEQGYEFCIFCESVFQKYSKsVQKKSNFHVSNKLIHLRNVLRRLLSNQCSGEIISELLDLMKKN 81 
40556176    1 MRNLKSCSNCKHNGLITEYNHEFCIFCQSVFQLSNK-VSKKSNFHVSNKLIHLRNVLRRLLSNQCSSDVITELRTVMNKN 79 
41057140    1 -MNLRMCGGCRRNGLVSDADYEFCLFCETVFPMGIR-VQKRSNFHVSNKLIHLRNVLRRLLSKQCSEEVIRDLRAMMDRH 78 
41057513    1 -MNLRLCGSCRRNGLVSDTDYDFCLFCETVFPMGIR-VQKRSNFHVSNKLIHLRNVLRRLLSKQCSEDVIRELREIMDRH 78 
9964519     1 MSDNIKCKYCNSFNIIKNKDIYSCCDCSNCYTTSSK-RITTISSASNNKTIHCNNVLKEISNTSISYDIVDGFLKLINDN 79 
9634835     1 MSNLKHCSNCKHNGLITESNHEFCIFCQSIFQLSNK-VSKKSNFHVSNKLIHLRNVLRRLLSNQCSSDVIVELKSVMTKN 79 
9629036     4 MNALRHCHGCKHNGLVLEQGYEFCIFCQAVFQHCAK-VAKRSNFHVSNKLIHLRNVLRRLLSKQCSGDIIAELRALMARN 82 
9627626     1 -MNLRLCSGCRHNGIVSEQGYEYCIFCESVFQKCTK-VQKKSNFHVSNKLIHLRNVLRRLLSHQCSGEIISELLDIMEKN 78 
115531786   1 MNSLKCCNSCKHNGLVTEYDYEFCVFCESIFTIHVK-TVKKSSFHVSNKLIHLRNVLRRLLSRQCSSHIIDEIMTDIERY 79 
113195299   1 -MNLRLCSGCRHNGIVSEQGYEYCIFCESVFQKCTK-VQKKSNFHVSNKLIHLRNVLRRLLSHQCSGEIISELLDIMEKN 78 
21492545   82 QISSEDVDANFVSSFLKAHERINKKDYKLVFEIINQVKSEKLN--LTTEKINEVVEIFKHLVFFCQENTPSKTINYSFFL 159
40556176   80 NISSKDIDANFVSSFLKANDKINKKDYKLVFEIINHIKEEKLN--LDTNKINEVIEIFKHLVFFCQENTSSKTINYSFFL 157
41057140   79 QIRPEDVDANYVSSFLKDSEMINKKDYKLVFEIINQVKNEKLD--LSTEKINEVIEIFKQLVFFCQEITPTKTINYSFFL 156
41057513   79 QIRPVDVDANYVSSFLKDSDMINKKDYKLVFEIINQVKNEKLN--LSTEKINEVIEIFKQLVFFCQESTPSKTINYSFFL 156
9964519    80 NLNTKSITTALGSEYLKSK---GIKNYRTTHKLINMSLSDGNNciLTKDDIFRINIIFEDFTQFIYKNNYTKTISYEFCL 156
9634835    80 NISSTDIDANFVSSFLKANEKINKKDYKLVFEIINHIKEEKLN--LDTSKINEVIEIFKHLVFFCQENTPSKTINYSFFL 157
9629036    83 QLAPADIDANFVSSFLKAHEKINKKDYKLVFEIINQIKDERLE--LDTQKINEVIEIFKHLVFFCQENTPSKTINYSFFL 160
9627626    79 QISTDDVDANFVSSFLKANERINKKDYKLVFEIINQVKDEKLN--LSTEKINEVVEIFKHLVFFCQENTPSKTINYSFFL 156
115531786  80 NISSQDVDANFVSNFLKEKDKINKKDYKLVFEIINHVRNDTLN--LTTEKINEIVEIFKLLVFFTQENTESKTINYSFFL 157
113195299  79 QISTDDVDANFVSSFLKANERINKKDYKLVFEIINQVKDEKLN--LSTEKINEVVEIFKHLVFFCQENTPSKTINYSFFL 156
21492545  160 DKIFDITLVTKNLKPQTVKNYTKNNSNQLIWENFLIYMKNKKKTANIIDFGHEYVFTDEKFT--------TCSLDI 227
40556176  158 DKIFNLTSVTSNLKPQTVKNYTKNNSNQLVWENFLEYMKNKKINTLVHDYGHEYVFVDYGFT--------TCSLEV 225
41057140  157 DKIFEVTGVTRNLRPQTVKNYAKNNSNQLTWENFLAHMRARKRAAQIPEFGHEYVFSPARFA--------ACSLDL 224
41057513  157 DKIFEVTGVTSNLRPQTVKNYAKNNSNQLTWENFLAHMRARKRAAQIQEFGHDYVFRHARFA--------ACSLDP 224
9964519   157 DRIFDILNINYVINFNYSKLNKRDDKPEI-WNKYIIELYNKS----LIKSNNKFIFRPNNIIfneyiknnICLRNI 227
9634835   158 DKIFSLTSVTNNLKPQTVKNYTKNNSNQLVWENFLDYMKKKKINTSVYDYGHEYVFVDYGFT--------TCSLEV 225
9629036   161 DKIFTLTSVTRNLRPQTVKNYTKNNSNQLIWENFLVYMRGKKLNTCVHDYGHEYVFVDHGFA--------ACSLEL 228
9627626   157 DKIFDITSVTKNLKPQTVKNYTKNNSNQLVWENFLAHMRSKKRVTMVEDYGHEYVFVDERFS--------TCSLEV 224
115531786 158 DKIFNVIGVTANLKPQTVKNYAKNNYNQLTWEKFLRFLDGKCLANNVVDYGHEYVFGTYDHS--------PCSLEV 225
113195299 157 DKIFDITSVTKNLKPQTVKNYTKNNSNQLVWENFLAHMRSKKRVTMVEDYGHEYVFVDERFS--------TCSLEV 224
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap