Conserved Protein Domain Family
PHA03073

?
PHA03073: PHA03073 
late transcription factor VLTF-2; Provisional
Statistics
?
PSSM-Id: 177518
View PSSM: PHA03073
Aligned: 25 rows
Threshold Bit Score: 235.674
Threshold Setting Gi: 115531785
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956371   1 MAKRLSLQDIVISNPKAVSKPtINDDALTCILPKYYNSVADINIHINSDNSYCWFCNQLLLVTP-FHVETMKGKYVGNFC 79 
115531785   1 ---MQRLAPISVSDPKAAAKS-GGGYVVSNILPNYFAVLASERQDVSEDGSACWFCRQPLEPDGaRRIETLFSRSFGYFC 76 
148912968   1 MAKRVTLPDITISSPKSVAKL-TKNECFSSILPKYYVSVADISIDTNSDNSYCWFCSQKLIIKP-LCIETIKGNNVGTFC 78 
18640174    1 MAKKVSLSNITISSPKAVIKQ-VKDESITSILPSYYTSEACMTVKMNHMCNCCWFCSQDIILSP-LHIETMKGNNVGNFC 78 
15150530    1 MAKRVTLPDITISSPKSVAKS-TKNECFSSILPKYYVPVADISIDTNSDNSYCWFCSQILIIKP-LCIETIKGNNVGAFC 78 
21492544    1 MAKRVTLPDITISSPKSVAKL-TKNECFSSILPKYYISVADISIETNSDNSYCWFCSQNLIIKP-LCIETIKGNNVGVFC 78 
9629035     3 APRRISLPSVTISAPRAVLRQ-ERQEPLSCVLPEYYYTVAQLRLQVNSERARCWFCSQAVGAAA-WAIETLHGHAVGSFC 80 
9634719     1 MYKKVNLSGIVISEPKSVKKF-KTKDSIVNVLPEYYHTIADKRLEIRKDKDNCWFCKQDMNTYNpYFIETLYGDHIGVFC 79 
41057512    1 -MKRIALCRVDISAPRASACPpPAAGRIEYVLPKYFNSVSSDRLALRAADGSCWFCKQRVGAAP-LAVETLDGAAIGEFC 78 
40556007    1 MYKKVNLSGIIISEPKSVKKN-RIKESINNVVPKYYQVLTDKNLKIKKDNNNCWFCKQQLNSFThYFIKTLYGDDIGFFC 79 
211956371  80 SKICRDSFATMIKSHVALREEPKITLLPLVFYDKPDEIINIINLLKNKEGIYGNCFYKENDQTVHISLRSLL 151
115531785  77 SRICADSFAAGVKHIIPLREDPKVSLLPLVCYRHPERVLAVINGLRDTAGVYGGVLFAKNR--IDIELKSFI 146
148912968  79 STICRDSFASMVKSHIALREEPKVTLLPLVFYDNPKEVINIINTLRNKEGVYGSCFYKERDKSIHVSLRSLL 150
18640174   79 SSICRDSFASMIKSNVALREEPKATILPLICYDKPNEIINIINLLRNKEGIYGNCYYKEKDNSIQISLRSLL 150
15150530   79 STICRDSFASMVKSHIALREEPKVTLLPLVFYDNPKEVINIINTLRNKEGVYGSCFYKEKDKSIHVSLRSLL 150
21492544   79 STICRDSFASMVKSHIALREEPKVTLLPLVFYDNPKEVINIINTLRNKEGVYGSCFYKEKDKSIHVSLRSLL 150
9629035    81 SRICRDSFASTVRTHVALREEPKVTLLPLVFFQHPEKVLELIRSLRSREGIYGTCFFDERAGAVTLTLRSLH 152
9634719    80 SKICRDSFANMIKSVIALREEPKISLLPLELYEKPEEVLEVINDLRHKEGIYGSCILESDKNIIKLTLRCHC 151
41057512   79 SRLCRDSFAGLVKHLVALREEPKIELLPLEMYADPDRVRALINETRELDGVYGRCYVERDGRAARMALKSLI 150
40556007   80 SKICRDSFANMIKGVIALREEPKVSLLPLEVYENPEEVIEIINELREKEGTYGNCILETDNN-IRLTLRCHC 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap