Conserved Protein Domain Family
PHA03071

?
PHA03071: PHA03071 
late transcription factor VLTF-1; Provisional
Statistics
?
PSSM-Id: 165360
View PSSM: PHA03071
Aligned: 25 rows
Threshold Bit Score: 422.264
Threshold Setting Gi: 115531744
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956338   1 MSLRIKIEKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALgGSVNIWAIVPLSASVFYDGKNNQVFNLPVSKVKACLCS 80 
9628999     1 MSVRIKIDKLRQIVTYFSEFSEEVSVNVDARSELMYIFSTLgGAVNIWAIVPLNANVFYDGGENCVFNIPVLKIKSCLCS 80 
12085041    1 MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNLMYIFAALgGSVNIWAIVPLSSSVFYEGEKNKVFNLPVSKVKSCLCS 80 
9633689     1 MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALgGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCS 80 
9633862     1 MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALgGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCS 80 
9634796     1 MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLgGSINIWTIVPLNSNVFYNGVENTVFNLPVLKVKNCLCS 80 
41057108    1 MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGLMYIFAALgGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCS 80 
41057481    1 MALRIKLEKLKQIVTYFSEFSEEVSVNVDVADGLMYIFAALgGSVNIWTIIPLSASVVYDGEVSRVFNVPVLKVKSCLCS 80 
38229220    1 MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNIMYIFAALgGSVNIWAMVPLSSSVFYEGENNKVFNLPVSKVKSCLCS 80 
40556109    1 MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLgGSINIWTIVPLNSNVFYNGSENYVFNLPVLKVKNCLCS 80 
211956338  81 FHNDAIIEIEPDfeNDLIKLSSFHVVSVDCNRELMPLRTDTCISLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIK 160
9628999    81 FHNDAVVTIEPDlqNDAVRLSSDHMVSVDCNHEPIPHRTGTVISLGIDQKKSYIFNFQRYEEKCCGRTVIHLELLLGFIK 160
12085041   81 FHNDAIIEIEPNidNDLVKLSSYHIVSVNCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIK 160
9633689    81 FHNDSVIEIQPDlvNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIK 160
9633862    81 FHNDSVIEIQPDlvNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIK 160
9634796    81 FHNDAVVSITADhdNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIK 160
41057108   81 FHPDSVVSLEPDleDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIK 160
41057481   81 FHPDSVVCLEPDleDNVIRLSSHHVVSVDCENEPIAHRTNTSICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIK 160
38229220   81 FHNDAIIEIEPNieNDLVKLSSYHIVSVSCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIK 160
40556109   81 FHNDAVVSITADheHNTVTLTSHYTVSIDCNNEQIPHNTGTSISLGIDQKKSYIFNFNKYEEKCCGRTVFHLDMLLGFIK 160
211956338 161 CISQYQYLTILFKDDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNVLG 240
9628999   161 CISQYQYLSIGFADKNLVLKTPGTRDTFVRRYSMTEWSPALQAYSFKIAIFSLNKLRGFKKKVVMFETKIVMDADDNILG 240
12085041  161 CISQYQHLTVLFKNDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLG 240
9633689   161 CISQYQYLTILFKDDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLG 240
9633862   161 CISQYQYLTILFKDDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLG 240
9634796   161 CISQYQYLNICFDDKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNILG 240
41057108  161 CIHQYQYITVCFRDKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPISSVNKLRGFKKRVVMFESRVVMDADDNIIG 240
41057481  161 CIHQYQYITVCFRDKKMVLHTPGKVDNYFREYSMTEWAPDLERFSFKIPISSINKLRGFKKRVVMFEARVVMDADDNIIG 240
38229220  161 CISQYQHLTVLFKNDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLG 240
40556109  161 CISQYQYLNVCFDDKKLVLKTPGTRDTFVRSYSMTEWSPALQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDAEGNILG 240
211956338 241 MLFSDRLPSFRINIFMSFQD 260
9628999   241 LLFRDRIGTYRVNVFMAFQD 260
12085041  241 MLFSDRLQSFRINIFMSFQD 260
9633689   241 MLFSDRIQSFKINIFMAFQD 260
9633862   241 MLFSDRLQSFKINIFMAFQD 260
9634796   241 LLFRDRIGTYKVNVFMAFQD 260
41057108  241 MLFTDRVGMYRVNVFMSFQD 260
41057481  241 MLFTDRVGVYRVNVFMSFQD 260
38229220  241 MLFSDRLQSFKINIFMSFQD 260
40556109  241 LLFRDKIGTYKVNVFMAFQD 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap