Conserved Protein Domain Family
PHA03070

?
PHA03070: PHA03070 
DNA-binding virion core protein; Provisional
Statistics
?
PSSM-Id: 177516
View PSSM: PHA03070
Aligned: 25 rows
Threshold Bit Score: 333.567
Threshold Setting Gi: 115531757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556114    1 MNNLFENLFGDKALCAT--VTREQLFDMVAAGAKYKFPKSLLSIYKIVPKIMTRYPMKLLTNESISGVVITTVYNLKKNL 78 
41057486    2 ASLL--SLVDADPLFCAg-LPSRDETMLVIAGARVRFPRSLLSLFHVVPRTMTRYETELVGTEMLVGAIFSTAYNVRRNL 78 
41057113    1 MTNLLSLVDQEDLAFCAg-FPSFDETMLVIAGARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNIRRNL 79 
9634801     2 NDLLLENLFGEKALCAQ--VTRDQLLEIIAAGARSKFPKSLLSMYRVTPRVMTRYPLKLITNESITGVVITTVYNLKKNL 79 
9629005     1 MNALFENLFDEDAVCAG--SVSREDFLLVVAGAKVKFPRSLLSMYRVVPRTMSRYELALVQSETVTGVVFTTVYNVRRNL 78 
9627597     1 MSLLLENLIEEDTIFFAgsISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNL 80 
22164680    1 MSLLLENLIEEDTIFFAgsISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELVLIHNENITGAMFTTMYNIRNNL 80 
20178466    1 MSLLLENLIEEDTIFFAgsISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNL 80 
17974996    1 MSLLLENLIEEDTIFFAgsISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNL 80 
113195271   1 MSLLLENLIEEDTIFFAgsISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNL 80 
40556114   79 SIPEkTKLTKQDIEKYYLDKNIEVLNLMISNTSVEDLACGRQRRkrtaKRKEPVIFLGVSAPIIVLMTSKKAVNTYVQDK 158
41057486   79 GLGE-EPVTMRDLERYFLDSENEVLTLVVNNTDFSNLSGVKKRGr---RIPNPVIFRSGSIPILMVLESRKKVNIYRERT 154
41057113   80 GLGE-DPVTMRDIEKYFLDSDNEVLTLIVHNTDFSAMSGVRRRGg--rRITNPVIFRSGSTPLLIVMESRKKTNIYRERT 156
9634801    80 NIPQnNKLTTQDIERYYLDKSVEVINLMVGNTSLGDLACGRPRRtkssKKKDPVIFLGISAPLILVMNSKKSINTYIQDK 159
9629005    79 GLEErEALSLPALEKYYLDKANDVLTLMVNNTNLEHIAAYRMRSr---RLLNPVVFRAGAVPLALVFTSRKKLSIYREDT 155
9627597    81 GLGD-DKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKKSGRr---KNKNMVIFRQGSSPILCIFETRKKINIYKENM 156
22164680   81 GLGD-DKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIP-KKSGr--rKNKNMVIFRQGSSPILCIFETRKKINIYKENM 156
20178466   81 GLGD-DKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIP-KKSGr--rKNKNMVIFRQGSSPILCIFETRKKINIYKENM 156
17974996   81 GLGD-DKLTIEAIENYFLDPNNEVMPLIINNTDMTTVIP-KKSGr--rKNKNMVIFRQGSSPILCIFETRKKINIYKENM 156
113195271  81 GLGD-DKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKKSGRr---KNKNMVIFRQGSSPILCIFETRKKINIYKENM 156
40556114  159 ESDPST-DYVNITPGIAVLENYGNTRLLDVHNPSAVLTVSAVYGLDSNMELKKLSTVAEMENYQNT-NIGKPIDLKKFTE 236
41057486  155 DEQANS-SYKEVGSNLAIVTRYAGLQLVDVHTPSSMLTVSAVYGVTEDKALKKIGNDKELADYQST-PLSDPIRLSDFTK 232
41057113  157 AEQANA-SYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGFTEDKGLKKLGSDKELADYQST-PLTDPIRLSDFSK 234
9634801   160 KSDPSS-DYVNINPGIGVLENYGNTYLLDIHNPSSVLTISTIYGLDNNMELKKLSTASEIDAYQDV-NIGKSVDLKKFNE 237
9629005   156 SQAAEDsTYTKIAANVALAGKYAGLLLLDVHTPGTALMLTAVYGLDDRRELRKLADSTALENHQQSgALSEAMKLSDFRA 235
9627597   157 ESASTE--YTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELELYSSS-PLQEPIRLNDFLG 233
22164680  157 ESAATE--YTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSS-PLQEPIRLNDFLG 233
20178466  157 ESASTE--YTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSS-PLQEPIRLNDFLG 233
17974996  157 ESVSTE--YTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSS-PLQEPIRLNDFLG 233
113195271 157 ESASTE--YTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSS-PLQEPIRLNDFLG 233
40556114  237 IFSTIKKHLSLSNFTM 252
41057486  233 LFDGVKKSIQLTNVPV 248
41057113  235 LFDGVKKSIQLTNVPV 250
9634801   238 IFNTMKKHLSLSNFSI 253
9629005   236 VFEGLKKSVPLTNLEM 251
9627597   234 LLECVKKNIPLTDIPT 249
22164680  234 LLECVKKNIPLTDIPT 249
20178466  234 LLECVKKNIPLTDIPT 249
17974996  234 LLECVKKNIPLTDIPT 249
113195271 234 LLECVKKNIPLTDIPT 249
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap