Conserved Protein Domain Family
PHA03069

?
PHA03069: PHA03069 
DNA-binding protein; Provisional
Statistics
?
PSSM-Id: 165358
View PSSM: PHA03069
Aligned: 2 rows
Threshold Bit Score: 215.371
Threshold Setting Gi: 9634773
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556068   1 MEESAGTPHHDPRYFVSPFILNTDDGRYLVLKAIKLCNVKTLDCMRKESSCVLKVEKPKSPCPIVAPDSGPQCIIQTTqq 80 
9634773    1 MEESAGTPFHDPKYFVSPFILNTDEGRYLVLKAIKLCNVRTIDCMKQETSCVLKVDKPQSPCPISSSDSAPKCYMQQT-- 78 
40556068  81 pnqQPNQQRQQTQLRFINTGPLSNIFSNTTDRAARMMNQ 119
9634773   79 ---SPQQQRQAPQLRFINTGALSNLFANTTDKAARVINQ 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap