Conserved Protein Domain Family
PHA03066

?
PHA03066: PHA03066 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165355
View PSSM: PHA03066
Aligned: 18 rows
Threshold Bit Score: 125.985
Threshold Setting Gi: 21492504
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195259   1 MTSLLYLILFLLFVCISYYFTYYPTNKLQAAVMETDRENAIIRQRNDEIPTrTLDTAIFTDASTVASAQIHLYYNSNIGK 80 
211956331   2 ASPLIYIFFFIIFLLVTYYFMYYPTNKLQLSVTRLNLENQLLKKRDDVFPS-SLNTLIFLNNEKFIPSTVNTYYNSSSGT 80 
157939674   2 ASFLVYLLFFIIFIVIAYYINYYPTNKLQIAVKNLNYEYQIYKQQDNDFPQ-KLNTLFFLDKQKFVSEEVNAYYNSSIGI 80 
148912928   1 MAYFFYLLSFIFFLLLLYYFSYYPTNKLLMSVKQKNEENNVIKNINNTFPT-SLNSIIFSKPESLSLTKIDTYYDSLSGT 79 
62637438    2 ASPLIYIFFFIIFLLVTYYFMYYPTNKLQLSVTRLNLENKLLKKRDDVFPA-SLNTLIFLNNEKFIPSTVNTYYNSSSGT 80 
38229213    2 ASLLTNLLFFIVFIIIAYCINYYPTNKLQMAVKNLNYEYEVRKQQDTNFPQ-KLNTIIFSDKEEFISDNVRAYYNASTGT 80 
18640134    2 ASSLLHLFFFIIFLIILYFINYYPTNKLQMSLKNLNTENIIIKQQNNNIPT-FLDTIIFTKPESAIPTRVNVYYDSALGI 80 
21492504    1 MAYFFYLISFIFFLLLLYYFSYYPTNKLLMSVKQKNEENNVIKNINNTFPT-SLNSIIFSKPESLSLTKIDTYYDSLSGT 79 
12085034    2 ASFLVYLLFFIIFIVIAYYINYYPTNKLQIAVKNLNYEYQIYKQQDNEFPQ-KLSTLFFLDKQKFVGEEVNAYYNSSIGI 80 
9633682     2 ASPLIYLLFFIIFLVLTYYFNKHPTNKLELSVDKLNRENKIIKQRDDAFPV-VLNTTVFTRPETPVPTKVHTYYDSATGV 80 
113195259  81 IIMSLNGKKHTFNLYDDNDIRTLLPILLLSK 111
211956331  81 VTVVSDNKKRVFRLDFDEDVRTLLPILLLSK 111
157939674  81 VTLLTKSKKLLFNINFSDDVSALLPILLLSK 111
148912928  80 VTAISNNKKYVFNLYFDEDIRTLLPILLLSK 110
62637438   81 VTVVSDNKKRVFRLDFDEDVRTLLPILLLSK 111
38229213   81 VAVLTSSKKLLFNVNFDDDVSALLPILLLSK 111
18640134   81 VTILENNKKRIFRLDFEEDVRTLLPILLLSK 111
21492504   80 VTAISNNKKYVFNLYFDEDIRTLLPILLLSK 110
12085034   81 VTLLTKSKKILFNINFSDDVSALLPILLLSK 111
9633682    81 VTMLSNNKKRIFRLDFDDDVRTLLPILLLSK 111
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap