Conserved Protein Domain Family
PHA03062

?
PHA03062: PHA03062 
putative IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 177512
View PSSM: PHA03062
Aligned: 12 rows
Threshold Bit Score: 77.0731
Threshold Setting Gi: 9628979
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956326  1 MALSAKEIFSAISLTLLALLMIISGGALAFKSLAPHRIVSMRSATFNRVVSILEYLAILIFIPGTIALYSAYIKKLFS 78 
157939669  1 MALSTREIFSAIGITCMALLMIVSGGALAFKSLAPHRVISMRSVTFNKVITILEYIAILIFVPGTIALYSAYIKTLIV 78 
148912923  1 MALSTRETFSLITVTLLAIFMIVSGSALLFKSFAPHRFMMAKSLTFDKILSFLEYAAIFIFVPGTVSLYSAYIKTLFK 78 
62637432   1 MALSAKEIFSAISLTLLALLMIISGGALAFKSLAPHRIVSMRSATFNRVISILEYLAILIFIPGTIALYSAYIKKLFS 78 
38229208   1 MALSTKEIFSAIGITCMALLMIISGGALTFKSLAPHRIIVMRSATFNKILSILEYVAILIFVPGTIALYSAYIKTLIL 78 
18640129   1 MTINTKDMFSLVSLTLLTIFMLACGGSLLFKTIAPHRLVITRSVTFNKVVNFLEYVAILIFIPGTITLYSAYVRTLFR 78 
15150485   1 MALSTRETFSLITVTLLAIFMIVSGSALLFKSFAPHRFIMARSLTFDKILSFLEYAAIFIFVPGTVSLYSAYIKTLFK 78 
21492499   1 MALSTRETFSLITVTLLAIFMIVSGSALLFKSFAPHRFIMARSLTFDKILSFLEYAAIFIFVPGTVSLYSAYIKTLFK 78 
12085029   1 MALSTREIFSAIGITCMALLMIVSGGALAFKSLAPHRVISMRSVTFNKVITILEYIAILIFVPGTIALYSAYIKTLIV 78 
9633677    1 MALTVKEVISFIGTTLLFVFMVLAGSALVFKTYAPHKVVVARSAAFMRVVNFFEFVAILVFIPGTLSLYWSYVKSLRF 78 
9633850    1 MALTAKEVISFIWMTLLFVVMLLAGSALLFKTYAPHKVVMTRSAAFMRVVNYFELVAILVFIPGTVSLYWSYVKSLRF 78 
9628979    1 MALPGKDIVAAVALTVLMLLMVVSGGALVTKGIPPLRLLTLRSARAARVVAVLEVVAVVLIVPGTLALYSAYVRQLWA 78 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap