Conserved Protein Domain Family
PHA03061

?
PHA03061: PHA03061 
putative DNA-binding virion core protein; Provisional
Statistics
?
PSSM-Id: 177511
View PSSM: PHA03061
Aligned: 25 rows
Threshold Bit Score: 447.959
Threshold Setting Gi: 115531729
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057466    1 MEEERLVFNKVNANVLKAYLCARISEIVDEMVDRRHMQKKKSAARRVELRIPVDLLHPAFVREFSLDSYKDGVLSSLVTS 80 
9634760     2 EQFDQLVLNSISAKALKSYLTTKIAEAIDELAAKKNSPKKKAQTKKPENRIPLDLINKNFVSKFGLKGYKDGVLNSLICS 81 
12085026    3 ECEEQLVLNNISARALKMYFTSKISDIVDELVMKKHPPKKKSQVKKPETRIPVDLIKEDFVKKFKLENYNNGVLISLVNS 82 
9628976     1 MEGDQLVLNSISAKALKAYLCQRLCEIVDEMVTRKAAPKKKQQTKKPEVRIPVDLIKPEFAARFGLHGYRDGVLASLIVS 80 
38229205    1 -MEEQIVLNNISARALKTYFTSKISDIVDELVIKKYPQKKKSQVKKPETRIPVDLIKEDFVKKFKLENYSSGVLTSLINS 79 
40556055    2 DQNDQLVLNSISAKALKSYLNTKISEAIDELVAKKNVPKKKTQSKKPENKIPLDLINKDFVSKFGLQDYKGGVLNSLICS 81 
62637428    3 ENDDQLVLNSISARALKAYFTSKINDMVDELVARKYPQKKKSQTKKLESKIPIDLIKKDFVKKFKLDNYNNGVLTVLINS 82 
157939666   3 ECEEQLVLNNISARALKMYFTSKISDIVDELVMKKHPPKKKSQVKKPETRIPVDLIKEDFVKKFKLENYNNGVLISLVNS 82 
115531729   2 DQAEGIILNNINAKLLKTYLMGKVNEAIDELVCKKIISKKKTSQKKYENKIPLDLINRDFVNKFNLSGYKEGILMSLIVS 81 
211956322   3 ENDDQLVLNSISARALKAYFTSKINDMVDELVARKYPQKKKSQTKKLESKIPIDLIKKDFVKKFKLDNYNNGVLTVLINS 82 
41057466   81 IVENNFFSsVDGKLVEGAERVLLLTPLETRILGCVPRESSLYIDVADVKALAGRLKSPPSCIECAGARYEIDARHVDDFI 160
9634760    82 LVENNYF--ENGKLKRGKHDELVLLDIEKEILARIDENSSLNIDVLDVKVLANRLRTNADRFEFKGHTYYLEQNKTEDII 159
12085026   83 LVENNYFT-SDGKLTKDAEKELVLTEVEKKILSVIPSSSPLYIDISDVKTLSARLKKSANSFFFKDCIYTLEPEKIEDLI 161
9628976    81 LVENNYF--EAGKLKPGEHPELVILDIEREILARVPPESALNIDVGDVKTLAARLRTSAHCFEFRGHTYFLEHDKTEEII 158
38229205   80 LVENNYFS-SDGKLTEDAKKELVITEVEKKILSSISPSSPLYIDISDVKTLSSRLKTSASSFFFKDCTYNLEPDKIEELI 158
40556055   82 LVENNYF--ENGKLKKGSCNELVLLDIEKEILSKIGKDSNLNIDVLDVKVLANRLKVNADRFEFKGHVYHLEQNKTEDII 159
62637428   83 LVENNYFS-KDGKLNDDAKNDLVLTDIEKKILEKIPKCSPLYIDISDVKILSMRLKNSANTFTFNNNLYSLEVDKIEDLI 161
157939666  83 LVENNYFS-SDGKLTKEAEKELVLTEVEKKILSVIPSSSPLYIDISDVKTLSARLKKSANSFFFKDCIYTLEPEKIEDLI 161
115531729  82 LIENTYF--EHGRLKRSLCQELPLVSYERDILCSIDEDSPLNIDSGDVKTLANRLKLNANSFTYKNITYVLEPNKNEEII 159
211956322  83 LVENNYFS-KDGKLNDDAKNDLVLTDIEKKILEKIPKCSPLYIDISDVKILSMRLKNSANTFTFNNNSYSLEVDKIEDLI 161
41057466  161 NTALRDGLISLDERSSLKDSMYCVDEELLCAMRRRFMRSPQISMGLISRSRLHDYLMRAMTREEHRIYVGLKDPASATVL 240
9634760   160 NQLIKNSAISMDMKNTIKDTFYMISDELLDVFKNRLFKCPQVKDNIISRARLYEYFIKATKPDDSKIYVILKDDNIAKIL 239
12085026  162 NQLSKNKAIILDEKNSVKDSVYLLTDELLDILKTRLFRCPQVKDNFISKTRLYDYFTRVTKHDDFKIYVILKDKRIADLL 241
9628976   159 NQLVRNGALTLDARNSVKDSFYTISDELLDVLRARLFRCPQVKDNTISRTRLYDYLIRMTKPDESRLYVILRDARLAELL 238
38229205  159 NQLSKNKAILLDEKSSVKDSVYLLTNELLDVLKTRLFRCPQVKDNFISKTRLYDYFTRVTKHDDLKIYVILKDEKIADIL 238
40556055  160 NQLIKNSAISMDMKNTIKDTFYVISEDLLEVFKNRLFKCPQVKDNIISRTRLYEYLMKATKPDESKIYVILKDKKIADIL 239
62637428  162 NQLAKNNDIILDERFSVKDSVYYIPNELLEVFKTRLFRCPQVKDNTISRTRLYDYFTRITKYEDPKIYVILKDIKIANIL 241
157939666 162 NQLSKNKAIILDEKNSVKDSVYLLTDELLDILKTRLFRCPQVKDNFISKTRLYDYFTRVTKHDDFKIYVILKDKRIADLL 241
115531729 160 NALVKNGAIRFEQKLSVKDSYYSIDEELLRLLKERFFRLPQVKDGVASRLKLYDFFTRIVKNDDTKIYVALKDESVGMMM 239
211956322 162 NQLAKNNDIILDERFSVKDSVYYIPNELLEVFKTRLFRCPQVKDNTISRTRLYDYFTRVTKYEDPKIYVILKNIKIANIL 241
41057466  241 GLETVCLGDFTYVKYTALVSALSAAIDRCNKRMHEDVYVRLAHVVPEN--SRMNVTKLVDALTVPMTRMEQPVQ 312
9634760   240 NIETIVIDHFIYTKHSLLVSSISNQIDKYSKKFNDQFYSSISEYIKDN--EKINLSKVIEYLTISTVKIENTVE 311
12085026  242 GIETVKLGSFLYTKHSMLVNSISMHIDRYSKKFQEPFYENIAEFVKDN--EKINVSKVIECLVVPSISLDKN-- 311
9628976   239 DIETVTVNHFVYTKHSLLVASVSAHVDKYSKRFGDAFYQGIAEYVKDN--EKINVAKVVDYLTVSTVKCAALEE 310
38229205  239 GIETIKIGSFIYTKHSMLVNSISVHIDRYSKKFQETFYENIAEFVRDN--EKINVSKVVECLIVPSILLDED-- 308
40556055  240 NIETITLDQFIYTKYSLLISAISNQIDKYSKKFNDQFYESISEYIKDN--EKINLSKVVEYLTVSTVKIDNNV- 310
62637428  242 GIETVKIGSFIYTKHSMLINSISSHVDRYSKKFQDDFYNSIAEFVKDN--EKVNVSKVVECLIVPNIIMDSNIE 313
157939666 242 GIETVKLGSFLYTKHSMLVNSISMHIDRYSKKFQEPFYENIAEFVKDN--EKINVSKVIECLVVPSISLDKN-- 311
115531729 240 GVPTVYIAPFHYTKLSILSSTIYENIDKYSKKFIHEFYDKIAEYIKDKdtEKVNVSRVIETLTLPTVKIE---- 309
211956322 242 GIETVKIGSFIYTKHSMLINSISSHVDRYSKKFQDDFYNNIAEFVKDN--EKVNVSKVVECLIVPNIIMDSNIE 313
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap