Conserved Protein Domain Family
PHA03056

?
PHA03056: PHA03056 
putative myristoylated protein; Provisional
Statistics
?
PSSM-Id: 165348
View PSSM: PHA03056
Aligned: 6 rows
Threshold Bit Score: 321.618
Threshold Setting Gi: 17974968
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17974968    1 METVATIQTPTKLMNKENAEMILEKIVNHIAMYISDESIYsENNPEYIDFRNRYGDYRSLIIKSDHEFVKLCKDHAEKSS 80 
18640293    1 MGTVATIPTPTKLMNKENVEMILEKIVDHIVMYISDESRD-ENNPEYIDFRNRYGDYRSLIIKSDHEFIKLCKYHAEKSS 79 
20178439    1 MGTAATIQTPTKLMNKENAEMILEKIVDHIVMYISNESSD-ENNPEYIDFRNRYGDYRSLIIKSDHEFVKLCKDHAEKSS 79 
22164652    1 MGTAATIQTPTKLMNKENAEMILEKIVDHIVMYISNESRD-VNNPEYIDFRNRYGDYRSLIIKSDHEFVKLCKNHAKKSS 79 
66275860    1 MGTAATIQTPTKLMNKENAEMILEKIVDHIVMYISDESSDsENNPEYIDFRNRYEDYRSLIIKSDHEFVKLCKNHAEKSS 80 
113195241   1 MGTAATIQTPTKLMNKENAEMILEKIVDHIVMYISDESRD-ENNPEYIDFHNRYGDYRSLIIKSDHEFVKLCKDHAEKSS 79 
17974968   81 PETQQMIIKHIYEQYLIPVSEVLLKPIMSMGDIFTYNGCKDNEWMLEQLSTLNFNNLYTWNSCSIGNVTRLFYTFFSYLM 160
18640293   80 PETQQMIIKHIYEQYLIPVSEVLLKPMMSMGDIITYNGCKDNEWMLEHLSTLNFNNLHVWNSCSIGNVMRIFYTFFSYLM 159
20178439   80 PETQQMIIKHIYEQYLIPVSEVLLKPMMSMGDIITYNGCKDNEWMIEQLSTLNFNNLRTWNSCSIGNVTRLFYTFFSYLM 159
22164652   80 PETQQMIIKHIYAQYLIPVSEVLLKPMMTMGDIITYNGCKDNEWMLQQLSTLNFNNLHTWNSCSIGNVTRLFYTFFSYLM 159
66275860   81 PETQQMIIKHIYEQYLIPVSEVLLKPIMSMGDIITYNGCKDNEWMLEQLSTLNFNNLRTWNSCSIGNVTRLFYTFFSYLM 160
113195241  80 PETQQMIIKHIYEQYLIPVSEVLLKPMMSMGDIITHIGCKDNEWMLEQLSTLNFNNLHVWNSCSIGNVTRIFYTFFSYLM 159
17974968  161 KDKLNI 166
18640293  160 KDKLDI 165
20178439  160 KDKLNI 165
22164652  160 KDKLDI 165
66275860  161 KDKLNI 166
113195241 160 KDKLDI 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap