Conserved Protein Domain Family
PHA03055

?
PHA03055: PHA03055 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165347
View PSSM: PHA03055
Aligned: 7 rows
Threshold Bit Score: 94.2636
Threshold Setting Gi: 66275871
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195254  1 MADAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRSVTIFKYIGLFIYIPGTIILYATYVKSLLMKS 79 
66275871   1 MVDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS 79 
9627580    1 MADAITVLTAIGITVLMLLMVISGTAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYIKSLLMKS 79 
17974979   1 MVDAITVLTAICITVLMLLMVISGTAMIVKELNPNDIFTMQSLKFNRTVTIFKYIGLFIYIPGTIILYATYVKSLLMKN 79 
22164663   1 MADAITVLTAIGITVLMLLMVISGTAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS 79 
20178450   1 MVDAITVLTAIGITVLMLLMVISGAALIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS 79 
18640306   1 MADAITVLTAIGITVLMLLMVISGTAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIYIPGTIILYATYVKSLLMKS 79 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap