Conserved Protein Domain Family
PHA03052

?
PHA03052: PHA03052 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165345
View PSSM: PHA03052
Aligned: 2 rows
Threshold Bit Score: 111.644
Threshold Setting Gi: 18640430
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627706   1 MQLPKGLVTSLGSNLTIVCKVSLRPPTTDADVFWISNGMYYEEDNEDGDGRISIANKIYTTDKRRVITL 69 
18640430  1 MQLPEGIVTSLGSNLTITCRVSLRPPTTDADVFWISNGMYYEEDDDDGDGRISVSNKIYTTDKRVLLHR 69 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap