Conserved Protein Domain Family
PHA03050

?
PHA03050: PHA03050 
glutaredoxin; Provisional
Statistics
?
PSSM-Id: 165343
View PSSM: PHA03050
Aligned: 7 rows
Threshold Bit Score: 207.563
Threshold Setting Gi: 17974974
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627575     1 MAEEFVQQRLTNNKVTIFVKFTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENKLHDYFEQITGGRTVPRIFFGKTSI 80 
17974974    1 MAEEFVQQRLANNKVTIFVKFTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGRTVPRIFFGKTSI 80 
22164658    1 MAEEFVQQRLANNKVTIFVKYTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGKTVPRIFFGKTSI 80 
18640301    1 MAEEFVQQRLANNKVTIFVKFTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGRTVPRIFFGKTSI 80 
20178445    1 MAEEFVQQRLANNKVTIFVKFTCPFCRNALDILNKFSFKRGAYEIVDIKEFRPENELRDYFEQITGGRTVPRIFFGKTSI 80 
66275866    1 MAEEFVQQRLANNKVTIFVKYTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGRTVPRIFFGKTSI 80 
113195249   1 MAEEFVQQRLVNNKVTIFVKFTCPFCRNALDILNKFSFKRGAYEIVDIKEFKPENELRDYFEQITGGRTVPRIFFGKTSI 80 
9627575    81 GGYSDLLEIDNMDALGDILSSIGVLRTC 108
17974974   81 GGYSDLLEIDNMDALGDILLSIGVLRTC 108
22164658   81 GGYSDLLEIDNMDALGDILSSIGVLRTC 108
18640301   81 GGYSDMLEIDNMDALGDILSSIGVLRTC 108
20178445   81 GGYSDLLEIDNMDALGDILSSIGVLRTC 108
66275866   81 GGYSDLLEIDNMDALGDILSSIGVLRTC 108
113195249  81 GGYSDLLEIDNMDALGDILSSIGVLRTC 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap