Conserved Protein Domain Family
PHA03048

?
PHA03048: PHA03048 
IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 165341
View PSSM: PHA03048
Aligned: 11 rows
Threshold Bit Score: 151.16
Threshold Setting Gi: 9633739
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633739    1 MDTMTILSNYFNTALIGGIVLLATACVFAFIDFSKNKSTv-TNAWRALSGITFVLGIVITVGMLIYSMWGRYCKPptKTT 79 
9633913    1 MDAMTIMSNYFNTALIGGIVLLATACVFAFIDFSKNKST--TNAWRALSGIAFVLGIVITVGMLIYSMWGRYCKPhtKTT 78 
12085088   1 MDVMGAINNYFNGALIGGIILLAASCIFAFVDFSKNKPT--VTIWRALSGIAFVLGIVITIGMLIYSMWGRYCTP--SKV 76 
15150544   1 MDIMGMISNYFSTALIGGIILLAASCIFAFVDFSKHKNNngITVWRALSGIAFVLGIVMTIGMLIYSAWGKYCSP--NKV 78 
18640188   1 MDVMNTIGNYFSSALIGGIILLAASCIFAFVDFSKNKAT--VTVWRALSGIAFVLGIVMTIGMLIYSMWGRYCTP--SKI 76 
21492558   1 MDIMGMISNYFSTALIGGIILLAASCIFAFVDFSKHKNNngITVWRALSGIAFVLGIVMTIGMLIYSAWGKYCSP--NKV 78 
62637491   1 MDIMGNLNNYFSGALIGGIILLSASCIFAFVDFSKHKAT--VTTWRALSGIAFVLGIVMTIGILIYSMWGRYCTP--SKI 76 
38229267   1 MDIMGAINNYFNGALIGGIILLAASCIFAFVDFSKNKPT--VTIWRALSGISFVLGIVITIGMIIYSMWGRYCKP--SKI 76 
148912982  1 MDIMGMISNYFSTALIGGIILLAASCIFAFVDFSKHKNNngITVWRALSGIAFVLGIVMTIGMLIYSAWGKYCSP--NKV 78 
157939728  1 MDVMGAINNYFNGALIGGIILLAASCIFAFVDFSKNKPT--VTIWRALSGIAFVLGIVITIGMLIYSMWGRYCTP--SKV 76 
211956385  1 MDIMGNLNNYFSGALIGGIILLSASCIFAFVDFSKHKAT--VTTWRALSGIAFVLGIVMTIGILIYSMWGRYCTP--SKI 76 
9633739   80 VVENGRY-NSSPIELNGQ 96 
9633913   79 VIENGRY-NSSPIELNGQ 95 
12085088  77 VIDNGRY-NSSQIELNGQ 93 
15150544  79 LIDGGRY-NSSAIELNGQ 95 
18640188  77 VIDGGRYnNSSAIELNGQ 94 
21492558  79 LIDGGRY-NSSAIELNGQ 95 
62637491  77 VID-GRY-NSSQIELNPQ 92 
38229267  77 VIDNGRY-NSSQIELNGQ 93 
148912982 79 LIDGGRY-NSSAIELNGQ 95 
157939728 77 VIDNGRY-NSSQIELNGQ 93 
211956385 77 VID-GRY-NSSQIELNPQ 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap