Conserved Protein Domain Family
PHA03047

?
PHA03047: PHA03047 
IMV membrane receptor-like protein; Provisional
Statistics
?
PSSM-Id: 165340
View PSSM: PHA03047
Aligned: 10 rows
Threshold Bit Score: 56.7229
Threshold Setting Gi: 148912983
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956386  1 MITNYEPLILIGIICIASLANIKLSSKIKLDIVFFLQSILFMWFTFHFIHSVF 53 
157939729  1 MITNYEPFILLGIICIALLANIKLSSKVKLDIIFFVQSILFMWFIFHFVHSVF 53 
148912983  1 MITNYEPLILFGIILITLLGNLKLSFKLKINIIFFIQSILFMWFIFHFVHSVF 53 
62637492   1 MITNYEPLILIGIICIASLANIKLSSKIKLDIVFFLQSILFMWFTFHFIHSVF 53 
21492605   1 MITNYEPLILFGIILITLLGNLKLSFKLKINIIFFIQSILFMWFIFHFVHSVF 53 
18640189   1 MVTNYEPLILLGIICVASLANIKLSIKVKMDIIFFIQSILFMWFILHFVHSVL 53 
15150545   1 MITNYEPLILFGIILITLLGNLKLSFKLKINIIFFIQSILFMWFIFHFVHSVF 53 
12085089   1 MITNYEPFILLGIICIALLANIKLSSKVKLDIIFFVQSILFMWFIFHFVHSVF 53 
9633740    1 MITNYEPVILLGIICFTVLVNFKLSTKAKIDVIFFIQSILFMWFIFHFVHSVF 53 
9633914    1 MITNYEPVILLGITCFTVLVNFKLSTKAKIDIIFFVQSILFMWFIFHFIHSVF 53 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap