Conserved Protein Domain Family
PHA03046

?
PHA03046: PHA03046 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165339
View PSSM: PHA03046
Aligned: 11 rows
Threshold Bit Score: 168.395
Threshold Setting Gi: 9633751
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633751     1 MDRVLSIYPGDEDESGD------EKNKCVGGKAAKQnnsekktnkvekavlitnvkasgaevrrerrgdmpdededeevs 74 
9633925     1 MDRVLSIYPGDEDESGD------EKTKRVSDKYPKPakngekktnkvekavlvtnvk----------asverrgdmpdid 64 
12085100    1 MDKILSMFPGDDEEEKSnpearvPNNEEAEKNNKNV-------------------------------------------- 36 
15150556    1 MDRALSIFPGDDDETNErninhrEKTSGEHGHYEDKl------------------------------------------- 37 
18640200    1 MENNKIIYPGDEEEVIDrve-yrDVASYKDDDFPYR-------------------------------------------- 35 
21492569    1 MDRALSIFPGDDDETNErninhrEKTSNDHGHYEDNl------------------------------------------- 37 
62637503    1 MEEPLTMFPGDDEEEED----------LEDGRYKER-------------------------------------------- 26 
38229279    1 MDKILSMFPGDDDENDEkkpnpeIRLVDEETEKNKS-------------------------------------------- 36 
148912994   1 MDRALSIFPGDDDETNErninhiEKTSGDHGHYEDKl------------------------------------------- 37 
157939740   1 MDKILSMFPGDDEEEKSnpearvPNNEEAEKNNKNV-------------------------------------------- 36 
211956397   1 MEEPLTMFPGDDEEEDV-----------EDGRYKER-------------------------------------------- 25 
9633751    75 vrlgdeaEEVEEEEPN-LKAIRVEIKKLIAEKYNFA-EIQEEDISDILKDSFIHKDRSDFKDIIIRLMVLEKLVQLTIKR 152
9633925    65 vedeaeeGGNGEEEPD-LVQIRNEIKKLIAEKYNFA-EIREEDISDILKDPFIHKKESSLKDLILRLMVLEKLVRLTVKR 142
12085100   37 ---------DENVKIN-KENIKKEILEILDNKYKTF-PVRDDHVNSILNDSFINDDVIDVKKIVLRLLVLEKLFTLLFDK 105
15150556   38 -------LDLSEEEPN-MIKIKNDIKKIINERYSNYiSIDDDEISDILKDSFISNEEMQIKDFVLRLLVLEKLFQTSVKE 109
18640200   36 --------DERKDDPDlLITVRNEIKKIIKDKYPTF-PIHELDISDILKDSFIHHDEMRIKDFILRLLVLEKIFQLSISN 106
21492569   38 -------LELSDEEPN-MIKIKNDINKIINERYSNYiSINDDEISNILKDSFISNEEIQIKDFVLRLVVLEKLFQTSVKE 109
62637503   27 --------IIDYEEPN-LISIRNDIKRLIKENYPTF-PIHESDISDILKDSFIHKDQMEIKDFVLRLMVMEKILKISIER 96 
38229279   37 -------ADVDNVNNNiKENIKKEILEILNSKYSSF-SVSDDQVFSILNDSFINDDVIDVKKIVLRLLVLEKLFTLLFNK 108
148912994  38 -------LDLSDEEPN-MIKIKNDIKKIINERYSSYiSINDDEISNILKDSFISNEEMQIKDFVLRLLVLEKLFQTSVKE 109
157939740  37 ---------DENVKIN-KENIKKEILEILDNKYKTF-PVRDDHVNSILNDSFINDDVIDVKKIVLRLLVLEKLFTLLFDK 105
211956397  26 --------IVDDEEPN-LISIRNDIKRLIKENYPTF-PIHESDISDILKDSFIHKDQMEVKDFVLRLILMEKILKISIER 95 
9633751   153 QKRHNKAIRRIENHLETVRKGMLMLSKKIDAQTGAL 188
9633925   143 QKKNNKSIHRIENHLETVRKGMLMLSKKIDAQTGVL 178
12085100  106 WSDSNDVIKRLEHHTDTVRKNMIILNKKIDVQTGRI 141
15150556  110 CNSLKNIIKRLENHIETIRKNMIVLTKKVDFQTGRS 145
18640200  107 YKTLENSMKRVENHLETIRRNMITLTKKIDVQTGRI 142
21492569  110 CNSLKNIIKRLENHIETIRKNMIVLTKKVDFQTGRI 145
62637503   97 CKVLENTVKRLETHTETVRRNMLTLGKKIDVQTGRI 132
38229279  109 WSISNDIIKRLENHTDTIRKNMIILSKKIDVQTGKS 144
148912994 110 CNSLKNIIKRLENHIETIRKNMIVLTKKVDFQTGRS 145
157939740 106 WSDSNDVIKRLEHHTDTVRKNMIILSKKIDIQTGRI 141
211956397  96 CKVLENTVKRLETHTETVRRNMLTLGKKIDVQTGRI 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap