Conserved Protein Domain Family
PHA03045

?
PHA03045: PHA03045 
IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 177510
View PSSM: PHA03045
Aligned: 21 rows
Threshold Bit Score: 155.597
Threshold Setting Gi: 40556197
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22164729    1 MITLFLILCYFILIFNIIVPAISEKMRRERAAYVNYKRLNKN-FICVDDRMFSYNFTTSGIKAKVAVDNK-NVPIPCSKI 78 
157939735   1 MITLFLVLCYFILIFNIIIPSISEKLQYEYNAYLKYKRLNSK-FICVDEKAFSYTFNLSGITANMAIDNN-GVPIPCSKI 78 
38229274    1 MITLFLVLCYFILIFNIIIPSILEKLQYEYNSYLKYKQLSNK-FICVDEKAFSYSFNLSGITANMVVDNV-GNPINCSKI 78 
21492564    1 MISLFLILCYFILIFNIIIPTVSEKLKREYETYTKYKNIKKD-FICVDNNLFYYDFNISGLSAKMLLDNNkQKPLRCSEI 79 
18640195    1 MITLFLILCYFILIFNIIIPIISEKMRREYDAYMKYKKLKNR-IICSDNRLFTYTFGISGIMARMAIDNN-FNPLPCSKQ 78 
15150551    1 MISLFLILCYFILIFNIIIPTVSEKLKREYDAYTKYKNIKKD-FICVDNNLFYYDFNISGLSAKMLLDNNkQKPLRCSEI 79 
12085095    1 MITLFLVLCYFILIFNIIIPSISEKLQYEYNAYLKYKRLNSK-FICVDEKAFSYTFNLSGITANMAIDNN-GVPIPCSKI 78 
9633746     1 MITLFLVLCYFILIFNIIVPAISEKMRKEYDAYLKYAHLKKD-AVCVDDRLFTYDFKTSGVVAKMFIDSN-GKPLPCSRT 78 
9633920     1 MITLFLVLCYFILIFNIIVPAIAEKMRKEYDAYLKYTHLKKD-AVCVDDRLFTYDFKTSGVVAKMFLDFD-GKPLQCSKV 78 
9629057     1 MFVLFLVLCYFILIFNMLVPAIAEKLRVEHDAFAALRQLHRErFVCVNGTLSTFEYTPFGVQALLPVDAK-GSPLPCALR 79 
22164729   79 NEVNNNkdvDTLYCDkDRDDIlPGFVRSCYRAYSDLFFTT 118
157939735  79 NNEKKY---NHVSCN----NI-HDLKNVCSKAYLNLFFTT 110
38229274   79 NNVKKY---NYISCN----DT-QDFKNICSKAYLNLFFTT 110
21492564   80 KKANKN---NYLSCEnNDNDI-VNFSRSCSNAYLNLFFTT 115
18640195   79 SDISKY---KYISCDtDGGDI-KNFRRSCSKAYLDLFFTT 114
15150551   80 KKANKN---NYLSCEnNDNDI-VNFSRSCSNAYLNLFFTT 115
12085095   79 NNEKKY---NHVSCN----NI-HDLKNVCSKAYLNLFFTT 110
9633746    79 RDIRSN---NAIYCD-NDENV-LDFRKSCSKAYLDLFFTT 113
9633920    79 HEIRHN---NVIYCD-NDINV-LDLRKSCSKAYLDLFFTT 113
9629057    80 DAAESS---HLVSCE-SGAGV-GRLRDACAGAYAELFLRI 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap