Conserved Protein Domain Family
PHA03043

?
PHA03043: PHA03043 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165336
View PSSM: PHA03043
Aligned: 7 rows
Threshold Bit Score: 176.172
Threshold Setting Gi: 9633951
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148913019   1 MGNKKNDDIKNIIKEYIRWRGNSekNICEERKLNIFFNKLKKIDSFVKKKIKESnndEYDIIKSMKLSLDDGPRMDKLPE 80 
211956428   7 IDTTVEKNIVDILKYYITWRGSS--DFYDKHDCGKIFKKLMLFDDHARKIMGDY---DYLFIKNMNLSLDDGPRLDKIDN 81 
62637534    7 IDTTVEKNIVDILKYYITWRGSS--DFYDKHDCGKIFKKLMLFDDNARKIMGDY---DYLFIKNMNLSLDDGPRLDKIDS 81 
21492592    1 MGNKKNDEIKRIIKEYIRWRGNGekNICEESELNIFFEKLKKMDSYVKKNIKESnndEYDIIKSMKLSLDDGPRMDKLPK 80 
15150581    1 MGNKKNDDIKHIIKEYIRWRGNGe-DICEERELNIFFKKLKKMDSFVKKNIKESnndEYDIIKSMKLSLDDGPRMDKLPE 79 
9633781     1 ------MYDEATIKRYIRWRGGD-----LDVPYEDVFETYTEFDAVAKKKFGEC---GYDLIKPMKLTLTDGPRLGKLPT 66 
9633951     1 ------MYDEDTVKRYIRWRGGD-----LDIPYEDVFETYMEFDILAKKKFGEC---DYDFIKPMKLTLTDGPRLGKLLT 66 
148913019  81 YLLDGLNAEEILGLCSIISEKVVSATYKVNWDRVYESLFNILDEKDLNYIKNKIM 135
211956428  82 NILSKLSYKELIGLCAVLAEKVVHYPYTIKWEKVFNTLFDRLTNEDFTEIKTFLN 136
62637534   82 NILSKLSYKELIGVCAVLAEKVVHYPYTIKWEKVFNTLFNRLTNEDLMEIKTFLN 136
21492592   81 YLLDGLNAEKILGLCGIISEKVVSETYKVNWDRVYESLFNILDEKKINYIKSKIM 135
15150581   80 YLLDGLNAEEILGLCGIISEKVVSATYEVNWDRVYESLFNILDEKDLNYIKSKIM 134
9633781    67 K--EPMTPEEAIGLCGLLAEKVTHSHYNVNWDVVFDELFSVMKR----------- 108
9633951    67 N--EHMTPEEAIGLCGILAEKVTHSHYDINWDVLFTELFSVMKL----------- 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap