Conserved Protein Domain Family
PHA03034

?
PHA03034: PHA03034 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165331
View PSSM: PHA03034
Aligned: 2 rows
Threshold Bit Score: 177.429
Threshold Setting Gi: 9964525
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631356   1 MIYYYINDNKYIIFGPIAQQYIDKC-KLQPFCVLKSSNRKYKLFGSLLYIDFINKNVFWEHSLHKYYKLYVTSIapyGNN 79 
9964525   1 MVWYFSINGLNIIFNNECQLYINNCfDNHTYCSLKEIDKPYKCFGCIIYLDFIIMKIYYENDVFTTFDLFNKNI---NNG 77 
9631356  80 FIINEMYPACSITSFIFPHLNLNLYniIIPSTCEHKNNCHNRYCKEHNSHLIGYNFPFAYNKHNI 144
9964525  78 NVVDNYIPTCSISDHFFPHHNKLFY--IKNKYCPHVNNCHDRFCIKHNVNLINVNFPFVKYNHDE 140
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap