Conserved Protein Domain Family
PHA03033

?
PHA03033: PHA03033 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165330
View PSSM: PHA03033
Aligned: 2 rows
Threshold Bit Score: 142.038
Threshold Setting Gi: 9964561
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964561   1 MRIEYINE---DFSTTDLNYNIISFISSDFVlCKDKCLIYIKKKYNSIKELKKQKKKSGEVAYIYKNNKYIIYIIIADYI 77 
9631358   1 MKIEYINKniwDFLSDIDNISLIVFISADYI-SSDDYFKYIKNKYNSIKTLKNQKKTKGEVSYIYKYNVYIYYILISDYI 79 
9964561  78 ESKVNILNILRALDNLKIILEKLKITDIMTSRSHIEDVYetDKLYKYLREIMPEELNLYLLL 139
9631358  80 EDIVDDINIRRSLSNFNELITTDNIATSMSHMKFILPNY--NNTLSYISDHITNIKNLYICL 139
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap