Conserved Protein Domain Family
PHA03031

?
PHA03031: PHA03031 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165329
View PSSM: PHA03031
Aligned: 2 rows
Threshold Bit Score: 378.966
Threshold Setting Gi: 9631365
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964487   1 MYysNHNLLIDFIKINFLIPKLYSISVSNNINNIEKYVKYHNKLAKNINKKYrkDLYKYIDIDELYNFKYSISNRKIPL- 79 
9631365   1 MY--NKYILEKLIRIKLLKPKIYIVTSNKSLNDIKKIVNVYNSLVKSINKAL--NLPSRLSIDGIVLKDLIWDNSKIIIk 76 
9964487  80 -------NINTKNCYFLNEiykkdiiKAYKYTSGIDSIIYHKINKVTDTILFLIYKNNGMERNSVGrckrleycINIWDA 152
9631365  77 nypyvyyEIGITNNFISSE-------KNYIYTDGVDCLIFKKTLKKSIISVYIQHASFKGNKKTSG--------FNIWDI 141
9964487 153 IHKLDYNLYYKLNLFLKKNSQIDYIRCILSSDNNLDMETIYLNIMNNINMYCKFNINILFYRKNNIYYYNDPLIFNNLEE 232
9631365 142 LPKIDYYLYCNINNCISMIDNISIRCLIISKDTNISMEELYISIMNGKSMHDELDIKIIYYDINKQRHFNHFNNFKVLPE 221
9964487 233 -DINLESNEIIFVDNKNSIGMCRNKISKvCKIINKEVDCNNTSLKLKFKNLVgtkvykILLNDIHLLYYYDINSDIYIYL 311
9631365 222 yDKKNDIANVILTYKNKKLFLYIKKLYN-SKIQNTVLNKNNLTYDLIVEDKI------IPLKKTYFLHYYKINKDIFYYN 294
9964487 312 DNSNIKKFYSNKLVIDNNIVISSkiFIHNFKIYNTTNELEKICIYNNIYELTKDYFKNINithNDDLYTSIEKIKKNNNI 391
9631365 295 DNNNNIKIFSNEINFDGLIDIDH--YEFNYKLYNKNSLFIKLCIASQIIDKYENEILNIN---DENIETVIKNIKKINNK 369
9964487 392 ELFKIMNKLINKTVKYHMqiisenKPIDLNKYDILFDFLTHIYKNSQSN 440
9631365 370 ILINNLSKLLNKSIKDHM------NEINININDIKYDYNLQTFVGKNSD 412
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap