Conserved Protein Domain Family
PHA03030

?
PHA03030: PHA03030 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165328
View PSSM: PHA03030
Aligned: 2 rows
Threshold Bit Score: 121.616
Threshold Setting Gi: 9964482
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631368   2 LNCVIYIVIILFVFVILFFYITSIKRDNFESTTHETDELANSTKSELETLDQKVINKFIQDSIINTRLSNIEESLNNIIS 81 
9964482   1 MSYIFLLLTFVIILLFIYYYIRIINRDTYELETQETESISNEFVDNIDNFNNDLIRKYISDMKLETRIKEVETEIETLKS 80 
9631368  82 KLQDNEVEKQVIEVNQPKEKKQEivrkRNITVKKEIENDEDE 123
9964482  81 ELNKKPEVKELIVLDQTNKIDDE----KLVDAVDKIETENKE 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap