Conserved Protein Domain Family
PHA03029

?
PHA03029: PHA03029 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165327
View PSSM: PHA03029
Aligned: 2 rows
Threshold Bit Score: 116.908
Threshold Setting Gi: 9964485
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631369  1 MTDAELYFLIIVIIVYIILILSTIGLIWGYLLSIRKIRSSIDQNMRSRRKGWYWFLNFLFWLLPLSLAAAFYFFTVWYVM 80 
9964485  1 MDNVEIVYYLLATVIYIIMILAIIGIIWGFLLSINKTRAAITQSIRTRRKGLYWFMNFTFWLVPFALVAGFYFFSIWFIM 80 
9631369 81 NPQAQQYWFPPP 92 
9964485 81 NPQAKIYWFPHP 92 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap