Conserved Protein Domain Family
PHA03028

?
PHA03028: PHA03028 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165326
View PSSM: PHA03028
Aligned: 2 rows
Threshold Bit Score: 212.985
Threshold Setting Gi: 9631370
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964459   1 MKSNLINLIDILKTKTYVINQYENKENYIYFDGDSYKYVKDTIDEKTDNIILTTEIKNTKIIYYIYKNIKnNFNINESDV 80 
9631370   4 NNPIYINLIDILRTRTFVLDQYERNQPIVYYDYDSYTKVNYKCEYEKNHIKLITEYNDSIIEYNLMNNVR-HIDTSQNNI 82 
9964459  81 ypepiimldnILSQYKKIINVFNNELLCIHYPTMVKQDNKTISHVSD-NVGIENLKPSADSSLIEYKILYHPVYMKELK- 158
9631370  83 ----------IISNQKSKHNEFDMNILSYHHPTYMKQNRMKVEFIPNvNDILTNYKPSIDSLCIDYKILYNSEIFKEYSd 152
9964459 159 --IISYKRSDMNILTSDDYRRCKPI 181
9631370 153 rlYIAYTSVNMSNVYETDYRKILYT 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap