Conserved Protein Domain Family
PHA03026

?
PHA03026: PHA03026 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165324
View PSSM: PHA03026
Aligned: 2 rows
Threshold Bit Score: 526.458
Threshold Setting Gi: 9964528
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631379   1 MKILNTLLDYINQIINMLFPNSEDeFNKLKIFENINIENKKTDEIIKIFKEIEHKIANYVKTELYKMNQQDYIILYNKIE 80 
9964528   1 MKIINSIIDSILSYIKLCIPKCEN-FEEFKCSFHIDVDNKSSEEIIKLLKIKYNELYNFLHTELSNLSLNDYKMIFNKIK 79 
9631379  81 SYIRSNNKPFELtpdeRQQIYEGLFTIKCYFDNEWMDKSITWIRNIFLHIIMIIIVSIIKHAIKTYMLTIKYIQDV-RKD 159
9964528  80 NTFNDLSIPNQY----KNFIHDKLLRLHFCLLYDHSEKLIFIIKEDFIAIFRCIIFYFIKKNIINYLETIKILNDVkKKE 155
9631379 160 TNLKTLIMLRNGILNIIVYKIIPIMLYiykhdtsnlpnafKYPPTDINELDTNKINNIIEYLKEEIeknmFNYISGFKKY 239
9964528 156 RNINKLIYMKKNIIELILKNICPLLLS-------------KYNTLKDNEFTYNNINKINDCLKREI----YNIKAGATKY 218
9631379 240 NMESINNMINVLKG--DNCDKLCNPDEAKELLNFLQDPHVQNMLLD-GEIDLPQKNVIKDLNSKILNNSEYVTLNIMNEL 316
9964528 219 NSETIQTMLSALENikENENPMYDKDKVNEFINFLKDPNTRKIICDnADIPYSFDETINKINVNTLDDENFISLNIFNEL 298
9631379 317 LDTNIGKKLMQIFTGSSSESLSNTILGAENKINNGINLNNNSFGFKDSDIVLITVMECLDAIRACANNSKNCCVKTP--S 394
9964528 299 MDTDIGHKLLRIFSGKTPNEISGIIFKGEEYANNGDILEDNSFGFRKGDIVLISVLECLDAIKKGYNNCNNPVMTIPngS 378
9631379 395 LTVNVNTPITKLSVDGTEFKL 415
9964528 379 ITVNVNTPISDIKINDTYLNL 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap