Conserved Protein Domain Family
PHA03025

?
PHA03025: PHA03025 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165323
View PSSM: PHA03025
Aligned: 2 rows
Threshold Bit Score: 93.8903
Threshold Setting Gi: 9964357
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631382  1 MIFdNLHCQGVDMTYYLYLKFIKKENSKKLREIIEPIKNNMVTIYLETVIVKNTLRNKDKPIEYISPI 68 
9964357  1 MVY-LLEYQGIFMTHYYYLYDTGKINAKQLAEICKKTKSTMIILKVITTIRNSTIQNKIKPMDMISPV 67 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap