Conserved Protein Domain Family
PHA03024

?
PHA03024: PHA03024 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165322
View PSSM: PHA03024
Aligned: 2 rows
Threshold Bit Score: 177.044
Threshold Setting Gi: 9964497
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964497   1 MFLVYFNTFLIIILLFGIIGIYILTFVFNIDFLINNNKIYILSYNATNINNINNLnlydYSDIIFLTNFNINNNLLVTQA 80 
9631383   6 TTYYIVNTIIVLILLAAVIVIYVFYFLNSPIVYKSVTKIIALNANGIALNNLNLL----YTTDMILINDSTIKGIEVSSE 81 
9964497  81 NNLQDIPIFNVNNI--ISNQYNFYSASSNNVNILLGLRKTLNiNRNPFLLFRNTSLAIVFNNNETFHCYISSNqNSDVLD 158
9631383  82 NNLKDLEVYTGDDVskYTNYLNFYSIYSGDQTVLVGISNAIQ-DIRPFIYFTPSIIAIVLVVNEICYCFMGSN-NSVADD 159
9964497 159 IVSHIEFMKSRYNKYVIIGEIPVNNNISINNIL--NNFAIITNVRLIDKYNSIISFlNINVGTLFVINP 225
9631383 160 IIATIYYITENYSSFVIVGPLTIEYTSQFLNIPinTDYRVITNKKILSLDTQIFSY-EIDPGILFTIGS 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap