Conserved Protein Domain Family
PHA03023

?
PHA03023: PHA03023 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165321
View PSSM: PHA03023
Aligned: 2 rows
Threshold Bit Score: 175.437
Threshold Setting Gi: 9631388
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631388   1 MVFLFFMIYFFILSINIILNKELYKLELDKKLYQVAEDDLKTTISCINDYWFIVKRNSRYLDLQYLRRNNNYVPCTTTPL 80 
9964563   1 MILLFFVVYFFIVIVNIIFYSILNRLYLDKLIFENAKNQLRTTVSCINDHWFVVRRNTRFLDLLAVKRDSEYLNCNTNPI 80 
9631388  81 ASDFLDSCGLNAKYNNKKEPCYAALLNLLFLL 112
9964563  81 SSDILESCGLNGRFNNRSEYCSQALLELMFTL 112
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap