Conserved Protein Domain Family
PHA03022

?
PHA03022: PHA03022 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165320
View PSSM: PHA03022
Aligned: 2 rows
Threshold Bit Score: 522.976
Threshold Setting Gi: 9631390
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964410   1 MYIKFKIECLRDRIKLLSIFNPYGTLWCDGKKCEIVITSDFKICVRIPFLETNIQELLSFNILYEKIGDLTLKNSISDTI 80 
9631390   1 MFIQFYVNVLRDRLKILSIFNPNGTLWCDGTKCEIVFTSNFKCCISIPFIKTNITELRGFDICYDKISELSLKNSIADKI 80 
9964410  81 ILKFNESGIMTQEEYNQNNVFYMTPDYTDIKSISYKSKKIDNYfNMFESITNVPIEPKLSDVEKIISDKLKSQLHDTGYS 160
9631390  81 TLTFKDNGIYVEELIFENNINIIDPKYISMQSISQINTPSNNN-NNFASAERIDDISDINETDNIISEKLELKKHDSGDL 159
9964410 161 NVMYMAYDNFTYVKDNEYKYMLDPSGYNNTALIFKIDMPILTNFIKKLIATKTSSVEIEFFPNYVKFSAYRNDNVKNSII 240
9631390 160 TIGYTIHDKFTLNTNNTYKYRINPNMYNKVGAVFKIKLDVLTEFIKKLMTTKGASIEMQVIKNTIKFKAYRTDNIKNNTI 239
9964410 241 DESVFYCSILQTYKRIYSKYKISSEQFCLLKKLNISITDFSAKDKKIYNSLQFNANIDnnnNENLNGLCIYPGMIGDEHK 320
9631390 240 DESCLYCSLINLYYPILRKYKIALNNFALLKKLNISISDFKAKDKKIYKYIQFNIIMQ---EDLVIGLCIYPGSANITNP 316
9964410 321 NEIKDYFIFMPILKY 335
9631390 317 EELQNYFIFMPVENY 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap