Conserved Protein Domain Family
PHA03020

?
PHA03020: PHA03020 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165319
View PSSM: PHA03020
Aligned: 2 rows
Threshold Bit Score: 498.347
Threshold Setting Gi: 9631457
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964383   2 SDNTTFMTNNIFGKELSTINDYLKSIFINKDCDRQILSNV-NVDNFNENRIKIFFLYTSILNNPIVCKNLKYVSEYIIED 80 
9631457   1 MSDNEYLNNISIQKDLPLLNTLLKNTFVKTENDKAILSKLtDGNNFNEDRIRTHALYTSIYSDCTALFRDKLNKMLVNKT 80 
9964383  81 LTSFS----CWETLSKMTENRETMGFPLIYKYilnnRNNRCVFDVLFESKIYQiNFNPVYDYTFSNTYRLDQIKFQKLLI 156
9631457  81 VSIYShelfCWLNLSDKVIKRESIGFPLIYKH----ERGKTGINILFETGKIS-TFNSVYNLTFGSRNVIDQLKFQKLLI 155
9964383 157 SYTLYRNNIFYSgKLHYDVYNVPKATIVFKIQDLYFNFDITTLVILSPLTKLYTLNGINTKTEYIYICDVLEQFKNKTEY 236
9631457 156 SYTLFKSNIMYD-TLIFDEFTIPETIITFKIQSMYFNIKLNVFVILSCKTSLYYADTSNSIIESKYINDALAYFKESTEY 234
9964383 237 NFIEYFILAFNKYIDYNNIPSGFPIIIKDLEQINERPIRGTIVKIrSNNDKYYYGILVDYFDDNYKIYIVTSTTKSTFNH 316
9631457 235 NFIEYFLLNFINLLDLNCIPIYSTILSTDTINISSTPPKGILVKF-LQNKKFNYGILADYFNCTYIIYYITESKPKKNEF 313
9964383 317 VETL--SRRHIFKSERIIAIVKNYIIGKndLC 346
9631457 314 LQHIvsSREDIFIAEDLIPIIKGYIIGK--VC 343
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap