Conserved Protein Domain Family
PHA03017

?
PHA03017: PHA03017 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165316
View PSSM: PHA03017
Aligned: 2 rows
Threshold Bit Score: 239.505
Threshold Setting Gi: 9631467
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964514   1 MSDITIYQSANIADSFFNDILNDSteknnkYIIFIDWNNSMVTYKNDGFViLRNNNGYSHDSYNNIIKNKNCKGFYIINN 80 
9631467   2 YDNLLVFDSCSIINSLFKEICFEN------YIIFIDWTNTIWDKYEDKYV-FRNGNIKTADDYNRVLNDNKCYGFYVITD 74 
9964514  81 NSSNSEDIHNYVESYDIDIEYIFNLNKLDPKISDnnniNYNIDFSYILSPKYKNTRYHNIIDSFLNDNFininPLIKNKL 160
9631467  75 NIQESSDAIFELQNLGIKSDLFQKRNKLDNKNTD----IYELSYYGIIKSKDDKLNTSRIIENFLKDNY----NFVLNKL 146
9964514 161 SIYIITSNMCNIIDILLFSNNQYHIFYYQTYDDEKLFIKKYGKSHHNKNVIYCGVINDTLNKIKSAWK 228
9631467 147 YIYYITGNMCNVVQNLIFSKIKKTILYIPSREDEIYLQDNIDKNNCYGGNNLCTIKRNLINISNIIKQ 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap