Conserved Protein Domain Family
PHA03016

?
PHA03016: PHA03016 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165315
View PSSM: PHA03016
Aligned: 2 rows
Threshold Bit Score: 383.925
Threshold Setting Gi: 9964347
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631538   1 MYDDFVELMYNEKFSLLTNKMVNDIITDYIFNNMNANFRLLYNLYNVLKNIFYKDKLIVKGGIASQLITqidNYNIRGDL 80 
9964347   1 MLKNIIDYINDNKINLYSMNDLQLDLNKNIFNSFTNNELFLSKLYNMIKSIYVNNSVIITDNNAESLLL---NQPFTGNL 77 
9631538  81 DISINIEPNKFNKIILdniKNKNKKTYKITDIFEYINDEKLINDISQIMENYKIEFEQISDNIDFNNMVPISSKYNNNIY 160
9964347  78 NIEIPLEREYIKSLLL---QYNSSESYRLENIFNNNILNNIINNLYTITNQYYYKITEKLNDLKLSDIVPERTKLNNNIY 154
9631538 161 IAGAYNKVYNVISNIKYGKFN--NNLKFNVNIVDNKfILIRFYYTIKFACNLKKHYDTFVIEKDKYKCKFLFLDISITPL 238
9964347 155 IVNPDEYIYYEFINSEKSNINmkNIIKYNISTYYDS-IMFYCYFDIDINCNKIEHHISSEINNYTTFTKFVFLKILFVPD 233
9631538 239 KTNNINNIEI--NTFLLDNKYNVINDQIQTLFHSFLLKHKIKKRVNRFIILFNKYKNELTQNSNqNRRYIDNKILYSRIK 316
9964347 234 KKIEIQNINKsnNIFSIYNTQYVINRSLSNLILSFIKYKNNIKEINNIKILLSKYKDNLSFNIN-NLKIRNVKVLLNKYR 312
9631538 317 YIFNDENILYNYYFFKDLISNDKLIYLINNISVFELKDVNIINVKPKKyIRKQLRKAIKIIDAIINSNLQAGNNDkeyey 396
9964347 313 NLFNSVVPLESYFAFRFTVNNDMFIYSTEDILDYGEIETKILDICPNK-IKKALKNFITIIDNILYNYIEISISN----- 386
9631538 397 DENILHLIANEFNLSNNECENIKYNKDLYKSYVKLYHNIYI 437
9964347 387 EENVLDKMINYFNLNKIEIDKIKKNKNTYNRYLRIYYLTDK 427
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap