Conserved Protein Domain Family
PHA03013

?
PHA03013: PHA03013 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165313
View PSSM: PHA03013
Aligned: 2 rows
Threshold Bit Score: 114.952
Threshold Setting Gi: 9964385
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631514   1 MVIKFVVQVIIIVAFVISLIIIYFPLSIYELVSKSYTYDPSNDINQKYNDNKLKIITLFMSNNTIYKAQGNITFDVIKNT 80 
9964385   1 MLFSWIINIIITICFIVSLVLLYYPLNIYELMSFTTIYDPIIAVNNNFNNNKLRQIYVFLSKNVIYKRQGIITYDLLNDT 80 
9631514  81 ITFKFSGNTYTFDIINDIDKYIAMYILAN 109
9964385  81 ITIRVRGNSYIFNINSDQSKFIPMIILAS 109
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap