Conserved Protein Domain Family
PHA03012

?
PHA03012: PHA03012 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165312
View PSSM: PHA03012
Aligned: 2 rows
Threshold Bit Score: 307.27
Threshold Setting Gi: 9964435
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631503  10 SINISEF----NTECSNECIIYEEDCKDYIAYT-DYPLEYKNIFSNITKLLSLIDNKTKFKVHRFLTVNLNKLSQFKIKT 84 
9964435   1 MIDPSDFltidNIEENIVNIPLEDECKEFIVFNkEYIYQYKNLFDNIIKLIYKLDENTKHKIHKFFTNNISKLHLFKSKT 80 
9631503  85 LLPCYISLYYLSLDNIILSNFGCKYIFKIDIKYKKISSIVNLASQIENNNIDYDnmRNNISYLIKGWCYILTLHNQQNFF 164
9964435  81 LLPCYVAMYYLYEQKIILNAAMCKYKFILEIKQKKINENINIISEILKKKINYP--KYDISYIIRGWVYTIDNNICKNLL 158
9631503 165 KFydvlYDIIGRIFIFNLQQNINL--KIKNIPTHFKIYKKIENYIYIALQLLS-YKMHFLIDENIKEMINYLSKMCIKKS 241
9964435 159 KY----FEIIPRIIIINLRLSINNkdKLSTIPTHFDIYKKIDNYVFILLYYISnYKIFTCHLDKIESINKVIYNNVINKS 234
9631503 242 HNKISYINYTLEifknEYKFPVISNDNNNESDEDIMLDD 280
9964435 235 HYKIIYTKYIID----NYIHPITQKNINNIDYYNCCNCN 269
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap