Conserved Protein Domain Family
PHA03011

?
PHA03011: PHA03011 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165311
View PSSM: PHA03011
Aligned: 2 rows
Threshold Bit Score: 109.259
Threshold Setting Gi: 9631498
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964394   1 MLLFFMSIILITVIIIIIYykIINIPP-GTNSLNNFDDEYLANLRFVPEQIFDFNIGDYNALIEQLEELRLRYNMLNDEY 79 
9631498   1 MKVYIILIILVSSLIMIIL--MINYSQyESNILRKLSNEYLSSLIYEPLVLNEYKEGDINEIKNIVDNLIAQYNELLQEY 78 
9964394  80 NNLVNERNIYLQLIQDQDEHIMNLRAQIDRLKTQIANNTN 119
9631498  79 QLIENNIKDLEIIIQENVDEIHFLTNEIDKLKENVTNLSI 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap