Conserved Protein Domain Family
PHA03010

?
PHA03010: PHA03010 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165310
View PSSM: PHA03010
Aligned: 2 rows
Threshold Bit Score: 692.56
Threshold Setting Gi: 9964530
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964530   2 FKKTTLFIFIFTIYNIKSQFICDKQ-SSDVVLQLPDILNCNNIEPIKAKIILRTLNEKSYSTNAILFTNIDFICTEPPSI 80 
9631494   1 MALIKVAIFAILILKVYSEYICTQSvHPDIIIKLPQNVNCKDSQYVETDITVKKINDDEYESNAVIVSAKVYKCTVHAVL 80 
9964530  81 YLNWAKTEYIIHHNIVEYNDIINVNKTHVFKNKTLIYNEDDNSYKYGKAKHFCVHYTFHYNTVIQEYINLKPGKVYYRKG 160
9631494  81 NIFSNFKETFIDYITLSKNEILKMNETCHYKNEELKYNELSSKYILGVPTYECVSYLFSQHTTEKTYVTMQRVKMYYKSH 160
9964530 161 TMLSNIANTYNCNYYTKYCQVSNSDVLVWDIDNNAKNEYNDSDAIDVDIIINNDNMHIIF--NYLNNPISLIVSKSKyEL 238
9631494 161 LMHTELGTLPSCEYSSQFCKIFNDLYITWEVNENATKDYKYYQTKGYMLYDENNNTHISFidNDTKTNVSVVIDDIN-NV 239
9964530 239 NKNNFINTNEHEFSIKILSILDlHRHKREIYNYGSK-----------IQYISDIIQTEKSQIHEMCEKISSMILRLYSIC 307
9631494 240 DNDSFIQTSNFAYKIKFNKMLK-DAYYRPITTYRTKrsydssdatdvLQYLYDISSENFNRIFQLCNEMSISIMELYALC 318
9964530 308 KVNAYSCISSLLNDKSISVNVVGNLYIVKKCLDVDIIEYKPSYNKYYDFCHELIPVIFSiKNKTFNGYYNTESTEIYYTS 387
9631494 319 AVSPKQCISVLINDTNINVNIVGNKYLINKCSSAKINKFLPSAEEYGCSLFPKVEILVQ-GSKISNCYYNTKTEQIFSST 397
9964530 388 RLIKKGkceNEQRFIsCNDNTNNQCIYNNILGGIE--KINNNIYTITKNNINellktIEPNNIN-PNFGYKPTLKDI--- 461
9631494 398 KYTSNC---NDITFV-CLDDPDSLCIYNHFTGNVTsfKVDKIINLGFKNNIY-----IEPPTFNiSSFISVPTLNDIapf 468
9964530 462 INSRITFNDFaefnhestIENYNNQSNEILALVVLCiilifmfVFSLIKILIIILKYMKKNIIKTN 527
9631494 469 INTNIHVSKY--------VQKHGLRLSAILIIVILS-------VFSIAIIAIFAIKFLHLRFTRSS 519
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap