Conserved Protein Domain Family
PHA03008

?
PHA03008: PHA03008 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165309
View PSSM: PHA03008
Aligned: 2 rows
Threshold Bit Score: 275.285
Threshold Setting Gi: 9964549
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9631486   1 MHIVAMSNLNYPRNVKMPEKCDLLFVSNITPLHDHNIISNFFDNIDNIDNVIFVPGDKDILFDD--TFNDRLHHHVYNRK 78 
9964549   1 MLINCMSNINLPVTNNIDFIGDIAIISNITHIHNKNLIKIFFKKFDDFKEIIFVPGNIDILFDNdiVINNEYIHNYHYRK 80 
9631486  79 ILRHSIlktynKNYSHNKYNLYVLTDDLITINFNNKPIKIYGQSHINIKLFNNTHIHKAlSGIAYINKNDKEI--RNHIQ 156
9964549  81 ILRNGL-----ETIDDNELDIIILRDELYEFDHFDDIIKIYGQSYSEDKKYKYSNINKN-EGISHLKSSKDIInyRNNIP 154
9631486 157 QCDILYTAYPPYAildNNLGCKDLFSRVMKVKPKFHIFNG---FSKPNRFIYKDITFINSNINHNNKHFTEIEY 227
9964549 155 KCDILITSSSPFG---DDNACGYLLSKVINIKPKYHIFNGltqYTHPSIVNYNDIIFVNSNIYNNKKKSYIINY 225
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap