Conserved Protein Domain Family
PHA03007

?
PHA03007: PHA03007 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165308
View PSSM: PHA03007
Aligned: 2 rows
Threshold Bit Score: 589.996
Threshold Setting Gi: 9631475
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964484   1 MEEDFDLISKPDIIYTPSLIDFINKYGLSNIFKNKKIISNYKFYILFISMQDYNLYKKIGLEYKLFILNFIKYIQDP-NV 79 
9631475   1 MENEFNKITKSSLLYTPIMNNLIEKYGIDKIFNNVCITNNSYFYILLIEMQNYDIYDKISKNYKLIIHNLLRQIMNStDL 80 
9964484  80 KKYIAEVIDTDNtnmYKNFSDYPILYLWKYVYNIKQSNINdyNDISSMMSIKHILNKDNDYKLytYNHNIIVKFLLFAWY 159
9631475  81 KEYINNIINIDN---YKNLSDYIINKFWDKVYNVPPSNIN--IDNIKNINVSSLLSKVVTYKY--YDPNKVTEFLIFTYY 153
9964484 160 SKYDLGVEILYKDTDD-EINNDEILNFINKEDSIFNYVNHNNkdYPLFNPSDDTIDsyanIRSEIISNNIEPGYIWKMPN 238
9631475 154 SKKDLAISILTNDDAEiDITFDNLLEIINNDRSIFSYINTNY--YPLFKSSLKTIE----YKFKVSDSNLDPGYLWKSRE 227
9964484 239 LINKLMSTGIAENITEKYFSILYNYLCNGVVTNNIICWTYLFGYGNVDPILLNKLFSIIMKIPIQLSGLISDLYNNKNFK 318
9631475 228 SFENLKNDGYAKNFNDVFFSILYSYIRNGFVTHNIIIWTYLFGYKILRQDLLKELFAIIKNIPIELSGIISDLLINKNYI 307
9964484 319 AIDNIKENISNNTTYNYfqGQCNINIDDALNGIPnNILNTIVEKDFTPQGYFINFGIDINKINFNENFFNILLNNNPIST 398
9631475 308 AIDEILNHDEPKITYEI--GQINVTSENVYNNYI-NVIESIAKKPFEPKGYFYNFDVDINKLKFNKKFFNFLFYNNPISK 384
9964484 399 SMDDIKNKIKNTYNKT-----YTKYYIDIYNTVNYINSNNNNFEAVIDYNFTILDEINEKNL--KYFNLPIIKKEILNIL 471
9631475 385 DILDLNMKIELNYKNNecgldYIDKYIKLYNTYNLINNNVSDFNVLYNYEYVKFDFNNMYDIieDLFELSIIKSSILKIL 464
9964484 472 YNKYYFIPDcNNINLSKQYNNFILKKSRLINIYNCLINSDIEKQVLDLMNKNTYLNILFS 531
9631475 465 FEEYSFIPK-NITNLRKQYMEHIKRKSNLNNLYEALTSKSYKKITDKIICSDIYLQSIFM 523
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap