Conserved Protein Domain Family
PHA03006

?
PHA03006: PHA03006 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165307
View PSSM: PHA03006
Aligned: 2 rows
Threshold Bit Score: 313.121
Threshold Setting Gi: 9631471
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9964452   1 MHVSKLVED---NNVIDIYNNENYPGKIQKHLFPTKIENYKMLYNYLNNDEfsiveecQEDLISNCSSINNDIGISKLYE 77 
9631471   1 MIISKVEYEninNNNVDLENDSNYPGYYPEFFKEQYINNVQELYTEPDNSN-------TNTIISKLIPIDDDIEDNNDEL 73 
9964452  78 EECMENNILIDDSVNNNEIKISIEDHNIIPSKKSSYFTDYMPEINIIENNNVNEklknviNVIEPNQDTIKDLSKTEIIK 157
9631471  74 NKLFDETIYNNENNDNDNDNVNYNTSVSITKSNKSSKSSIKTEINIFNEQNTKS------SQFTKKTSPIRPPSNTELLK 147
9964452 158 KLNNENSELKKKVKSMEKSENLNELMKKLNMCGNELINKKYVIINYAKTLGISLPLIDFEILDIKEIEEMYDIIETIKIK 237
9631471 148 QLKDENKKLKKQQYKTSKSKNMQLLISKLNGFCEQSLNKKKEILNFAIKQDITLSIDDFKYMDEDEIEEIYQLIKNINIH 227
9964452 238 KNSYDISNTVIRLIFSGIEKILVSTLNLNIFIDISKEITEDYIETKCKATKNFISNNISVPEYPFIDILLQIIYKIIGNY 317
9631471 228 KQSFNTSMIIIKLIFVCIEKCLVDVFKLTEFKNMVSVITDEFIDNKCNTTKTFINNYVSTPNIPFMDIGIQIVGIGIKNY 307
9964452 318 VNF 320
9631471 308 FNV 310
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap