Conserved Protein Domain Family
PHA03004

?
PHA03004: PHA03004 
putative membrane protein; Provisional
Statistics
?
PSSM-Id: 177507
View PSSM: PHA03004
Aligned: 24 rows
Threshold Bit Score: 437.613
Threshold Setting Gi: 40556060
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057086    1 MVDSGTHDVDSAAQERTPNQQTFFTKGLSPLMRHTYIYNNYAYGWIPETALWSSRLGDYRVTDFYPISLGMLKKFEFMFS 80 
41057459    1 MVDVNTHDVDAAAQLRTPNQQTFFTKGLSPRMRHTYIYNNYAYGWIPETAVWSSRLGDYSVTDFYPISLGMLKKFEFMFS 80 
40556060    2 AAVRPITDIYGISQDRDDKQLTINRRGDPPFLSNTFIYHDYAYGWIPETALWNSQYERLDLRDYYPITEGLLNKFEFMLD 81 
62637424    1 ---MNVEDIYAESQKRNNDQQTFFTRNLSPLMKNTYLYHNYSYGWIPETSIWSSRFANLDVTDYYPITINLLKKFEFMMA 77 
18640121    1 ----MGDDIYTESQKRNDDQKTFFTRNLSPLLKNTYIYHNYAYGWIPETVIWSSSYANLDIRDYYPITINLLKKFEFMLS 76 
21492491    1 -----MGDIYSESQKRNNDQKTYFTRNLSPLMKNTYLYHNYSYGWIPETAIWSSRFANLDVTEFYPITINLIKKFEFMLS 75 
9628970     1 MAALSVHDVHSAAQRRAPSQQTLFTRGLRPLMRNTYLFHNYAYGWIPATAAWSSRFADLDVTDYYPVSLGLLRKLEFMFS 80 
9633842     4 PPPPLPLDIYEESQRRNDDQKTFFTRTLSPLLKNTYLYHNYAYGWIPETVIWSSRFANLDVTDYHPITLNLLKKFEFMLS 83 
9633669     2 AGPPAPLDIYEESQRRNDDQKTFFTRALSPLLKNTYLYHNYAYGWIPETVIWSSRFANLDVTDYHPITLNLLKKFEFMLS 81 
211956318   1 ---MSIEDIYTESQKRNNDQQTFFTRNLSPLMKNTYLYHNYSYGWIPETSIWSSRFANLDVTDYYPITINLLKKFEFMMA 77 
41057086   81 LLADPggaCPAYEPKLNTEFLNRGSFSGRYVNPFHRFAALPEREYISFLLLSSVPIFNILFWFKGETFDTAKHSLLGAVY 160
41057459   81 LLADPggaCPAYTPKLNTEFVNQGSFSGRFVNPFHRFAVLPEREYISFLLLTSVPIFNILFWFKGETFDTAKHSLVGAVF 160
40556060   82 LDKRP---NLQYTPKINSPRLDNVS-AIRISTYFKKFTILPTDQYISFLLLTSIPIYNILYFFKNTAFNPAIHSLFNAFY 157
62637424   78 LYKGP---ILPYEEKINTEFISKGSFYGRYINFLRNFSILPTNEFISFLLLTSIPIYNILFWFKSTQFDIKKHTLFSEVY 154
18640121   77 LYNGP---ILPYEEKINTEFISRGSFSGRYINFLRNFSQLPTSEFISFLLLTSMPIYNILFWFKNTPFDITKHTLFNNVF 153
21492491   76 LYDGP---ILQYEEKINTEFISRGSFSGRYINFLRNFSLLPTSEFISFLLLTSIPIYNILFWFKNTQFDIKKHTLFSEVY 152
9628970    81 LYRGP---PLQYLPRVNTEFVSTGAFLGRFDDFFKRFAILPTREFISFLLLTSLPAYNLLFVFRGTRFELDKHTLFSAFY 157
9633842    84 LYTGP---VLPYEEKINTEFISRGSFSGRYINFLRNFSILPTDEFISFLLLTSMPIYNILFWFTNTRFDITKHTLFSKVY 160
9633669    82 LYTGP---VLPYEEKINTEFISRGSFSGRYINFLRNFSILPTDEFISFLLLTSMPIYNILFWFTNTQFDITKHTLFSKVY 158
211956318  78 LYKGP---ILPYEEKINTEFISKGSFYGRYINFLRNFSILPTNEFISFLLLTSIPIYNILFWFKSTQFDIKKHTLFSEVY 154
41057086  161 TTPERHIELARYLRRTGDYKPLFSRLGNDD----TYSKP-FS-GFTRI----SNPTPIGRL-PPSDFETLANLSTILYYT 229
41057459  161 TTRERHVELARYLRRTGDYKPLFSRLGNDE----TFDRA-FS-GFTRI----SNPTPVGRL-PPSDFETLANLSTILYFT 229
40556060  158 IDNQTHIELAKYLIRGGDYKPIFNMLNERS----LYDEN-LPlPPNILglirNRPGVGLQQ-QYTDLESLASIAAIITYT 231
62637424  155 SNNDRHIELAKYFRQSGDYKPLFSRLKEDN----IYTQP-FPlNTSRI----LHQNLPNSS-TISDYETLSNLSAILYLT 224
18640121  154 TTNEKHIELGKYFRQRGDYKPLFSRLKDDN----IYLLP-FPiNQSRI----QQNTGNVSY-----YETLSNLSAILYLT 219
21492491  153 TNNDKHIELGKYFRQTGDYKPLFSRLKDNN----IYTLP-FPiNQSNI----NNPTLPIGF-SKSDYETLSNLSAILYLT 222
9628970   158 TTRERHVELARYFRHGGDYKPLFGHPDATGdgsvTGDGRsLPrGSASA----LMSNGPRGRlVPSDYETLANLSAILYFT 233
9633842   161 TNVANHVTLARYFRHSGDYKPLFSRVDDNA----IYAAP-FPiNQSRI----IHQRTPPGT-AISDYETLSNLSAILYLT 230
9633669   159 TNNANHVALARYFRHSGDYKPLFSRVDDNA----IYTAP-FPiNQSRI----IHRRTPPGT-AVSDYETLSNLSAILYLT 228
211956318 155 SNNDRHIELAKYFRQSGDYKPLFSRLKEDN----IYTQP-FPlNTNRI----LHQNLPNSS-TISDYETLSNLSAILYLT 224
41057086  230 RYDPVLCFLVFYVPGLSATTKITPGVEFLMEKLSLAPENVVLL 272
41057459  230 RYDPVLMFLVFYVPGMSVTTKITPGVEFLMEKLSLTAEDVVLV 272
40556060  232 KRDPVIAFLMFYLPGLSVTTKITPAVEMLMKKLGLTKENIILV 274
62637424  225 NYDPVLMFLAFYVPNISVTTKITPGVEYLMKKLNMDKKDITLI 267
18640121  220 NYDPVLMFLAFYVPNISVTSKITPGVEYLLSKLNMKKTDVVLV 262
21492491  223 NYDPVLMFLVFYVPKISITTKITPAVKYLMDKLNMNETDITLV 265
9628970   234 DYDPVLMFLAFYIPSFSVTTKITPGVEYLMERLQVRLEDVTLV 276
9633842   231 NYDPVLMFLAFYVPNISVTTKITPGVEYLLQKLNMTPADVTLL 273
9633669   229 NYDPVLMFLAFYVPNISVTTKITPGVEYLLQKLNMTPTDVTLL 271
211956318 225 NYDPVLMFLAFYVPNISITTKITPGVEYLMKKLNMDKKDITLI 267
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap