Conserved Protein Domain Family
PHA03003

?
PHA03003: PHA03003 
palmytilated EEV membrane glycoprotein; Provisional
Statistics
?
PSSM-Id: 177506
View PSSM: PHA03003
Aligned: 25 rows
Threshold Bit Score: 463.752
Threshold Setting Gi: 115531703
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057447   1 MWP--FSSIPVGAECRVVETLPAEVs-SLQVGNMSTFECFSAIVESATKFLYIASFCCNLGSTREGVDVKDKLCTLAKSG 77 
9634778    1 --MgnIFKPIPKADYQIVETVPQSLt-AINSTNLSTYECFKRLIDLAKKEIYIATFCCNLSTNPEGTDILNRLIDVSSK- 76 
9628953    1 ---mgNLTSARPAGCKIVETLPATLplALPTGSMLTYDCFDTLISQTQRELCIASYCCNLRSTPEGGHVLLRLLELARAD 77 
22164641   1 MWP--FASVPAGAKCRLVETLPENM--DFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKG 76 
20178427   1 MWP--FASVPAGAKCRLVETLPENM--DFRSDHLTTFECFNEIITLAKKYIYIASFCCNPMSTTRGALIFDKLKEASEKG 76 
18640282   1 MWP--FTSAPAGAKCRLVETLPENM--DFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKG 76 
17974958   1 MWP--FVSVPAGAKCRLVETLPENM--DFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEVSEKG 76 
66275849   1 MWP--FASVPAGAKCRLVETLPENM--DFRSDHLTTFECFNEIITLAKKYIYIASFCCNPLSTTRGALIFDKLKEASEKG 76 
40556073   1 --MgnSFKRLPKPDYQIVETIPQSLt-AINTNNLSTYECFKKLIDIAKKEIYIVTFCCNLGSNPEGIDILNRLIDISAK- 76 
41057074   1 MWP--FSSIPVGADCRVVETLPAEVa-SLAQGNMSTLDCFTAIAESAKKFLYICSFCCNLSSTKEGVDVKDKLCTLAKEG 77 
41057447  78 VNVTVLVDVQSKDRDAEELREA--GVNYYKVKVSGRDD--VGNLLGSFWISNAGQWYVGSASLTGGSISNIKNLGVYSTN 153
9634778   77 VSVYILVDESSPHKDYEKIKSS--HISYIKVDIGVLNNesVGNLLGNFWVVDKLHFYIGSASLMGNALTTIKNMGIYSEN 154
9628953   78 VRVTIIVDEQSRDADATQLAGVp-NLRYLKLDVGELPGgkPGSLLSSFWVSDKRRFYLGSASLTGGSISTIKSLGVYSEC 156
22164641  77 VKIIVLLD-ERGKRNLGELQSHcpDINFITVNIDKKNN--VGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDY 153
20178427  77 VKIIVLLD-ERGKRNLGELQSYcpDINFITVNIDKKNN--VGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDY 153
18640282  77 IKIIVLLD-ERGKRNLGDLQSHcpDINFITVNIDKKNN--IGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVFSDY 153
17974958  77 IKIIVLLD-ERGKRNLGELQSHspDINFITVNIDKKNN--VGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDY 153
66275849  77 IKIIVLLD-ERGKRNLGELQSHcpDINFITVNIDKKNN--VGLLLGCFWVSDDERCYVGNASFTGGSIHTIKTLGVYSDY 153
40556073  77 IPVYILVDENSPHKDYERIKSS--HIKYIKVDVGVLNNesVGSLLSNFWVVDRCHFYIGSASLMGNALTTIKNMGIYSEN 154
41057074  78 VDVTLLVDVQSKDKDADELRAA--GVNYYKVKVSTKEG--VGNLLGSFWLSDTGNWYVGSASLTGGSVSTIKNLGLYSTN 153
41057447 154 RHLATDLMNRYNTFYSMIVEPKVpFSRLCCAMITPTATDFHLDHAGGGVFFSDAPEKFLGFYRTLDEDLVLHRIDSAKNS 233
9634778  155 NSLAMDLYFRSLDYKIISKKKCLfFTRM--------ATKYHFFKNHNGIFFSDSPEHMVGRKRTFDLDCVIHYIDAAKST 226
9628953  157 EPLARDLRRRFRDYERLCARRCV--------RCLSLSTRFHLRRHCENAFFSDAPESLIGSTRTFDADAVLAHVQAARST 228
22164641 154 PPLATDLRRRFDTFKAFNSAKNSwLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTS 233
20178427 154 PPLATDLRRRFDTFKAFNSAKNSwLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTS 233
18640282 154 PPLATDLRRRFDTFKAFNSVKNSwLNLYSSACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLRSAKTS 233
17974958 154 PPLATDLRRRFDTFKAFNSAKNSwLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTS 233
66275849 154 PPLATDLRRRFDTFKAFNSAKNSwLNLCSAACCLPVSTAYHIKNPIGGVFFTDSPEHLLGYSRDLDTDVVIDKLKSAKTS 233
40556073 155 NSVAQDLYLRCVDYKIISKKKCLmLTRL--------ATQYHLLKSHNGIFFSDSPERMIGRKRTYDLDCVIHYIDAAKST 226
41057074 154 KHLAWDLMNRYNTFYSMIVEPKVpFTRLCCAVVTPTATNFHLNHSGGGVFFSDSPERFLGFYRTLDEDLVLHRIENAKNS 233
41057447 234 IDLSLLSLVPVIRHADRVEYWPRIMDALLRAAIDRSVRVRVIVTEWKNADPLSVSAARTLNDFGVGSiDISTRLFSIPgr 313
9634778  227 IDLAIVSLLPTKRTKDSIVYWPIIKDALIRAVLERGVKLRVLLGFWKKTDVISKASIKSLNELGVDHiDISTKVFRFPvn 306
9628953  229 IDMELLSLVPLVRDEDSVQYWPRMHDALVRAALERNVRVRLLVGLWHRSDVFSLAAVKGLHELGVGHaDISVRVFAIPga 308
22164641 234 IDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQN-DLSVKVFTIQ-- 310
20178427 234 IDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATAKSLDALCVQN-DLSVKVFTIQ-- 310
18640282 234 IDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQN-DLSVKVFTIQ-- 310
17974958 234 IDIEHLAIVPTTRVDGSSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQN-DLSVKVFTIQ-- 310
66275849 234 IDIEHLAIVPTTRVDGNSYYWPDIYNSIIEAAINRGVKIRLLVGNWDKNDVYSMATARSLDALCVQN-DLSVKVFTIQ-- 310
40556073 227 IDLEIVSLLPTKRTKDAIVYWPIIKDALIRAVLERGVKLRILLGYWKKTDIISKASIKSLNELGVDSiDITTKVFIFPin 306
41057074 234 IDLSLLSMVPVIKHAGAVEYWPRIIDALLRAAINRGVRVRVIITEWKNADPLSVSAARSLDDFGVGSvDMSVRKFVVPgr 313
41057447 314 d--daaNNTKLLIVDDTFAHVTVANMDGTHYKYHAFVSVNAEKGDIVNQLSAVFERDWRSQYCKPIN 378
9634778  307 skvddiNNSKMMIIDGRYAHVMTANLDGSHFNHHAFVSFNCMDQQFTKKIAEVFERDWISPYAKEID 373
9628953  309 kg-davNNTKLLVVDDEYVHVTSADMDGTHYARHAFVSFNCAERAFARALGALFERDWQSSFSSPLP 374
22164641 311 ------NNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLK 371
20178427 311 ------NNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLK 371
18640282 311 ------NNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKELVSEAKKIFERDWVSSHSKSLK 371
17974958 311 ------NNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLK 371
66275849 311 ------NNTKLLIVDDEYVHITSANFDGTHYQNHGFVSFNSIDKQLVSEAKKIFERDWVSSHSKSLK 371
40556073 307 skvddiNNSKMMIVDNRYAHIMTANLDGSHFNHHAFISFNCIDQNLTKKIADVFERDWTSNYAKEIT 373
41057074 314 d--daaNNTKLLIVDDTFAHLTVANLDGTHYRYHAFVSVNAEKGDIVKDLSAVFERDWRSEFCKPIN 378
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap