Conserved Protein Domain Family
PHA03002

?
PHA03002: PHA03002 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165303
View PSSM: PHA03002
Aligned: 15 rows
Threshold Bit Score: 791.239
Threshold Setting Gi: 21492495
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148912919   2 SPSYIYPKRARDALSKIISSSITIERFlnSNVFVDTILEFGFHGILPVSLYNRAIDFDINNLKYFPVESIRLDDLINLLL 81 
157939664   1 MTLYMYPKNARKALSKLISKKLIIDKV--SKKHIKSLLDYGIHGLLPESVYDYAIRVDIKNIRFFQPNVVRITDLIKVLK 78 
62637427    1 --MYMYSRKARNAISKIISNKLDFDKI--PKSCFDVIIKYGLHGNLPSKFYDKAIEFDIANIRFMPSDSVKVEDLIELID 76 
15150481    2 SSSYIYPKRARDALSKIISSSITIERFlnSNVFVDTILEFGFHGILPVSLYNRAIDFDINNLKYFPVESIRLDDLINLLL 81 
17974973    1 --MFMYPEFARKALSKLISKKLNIEKV--SSKHQLVLLDYGLHGLLPKSLYLEAINSDILNVRFFPPEIINVTDIVKALQ 76 
18640124    1 MPSYMYPKNARKVISKIISLQLDIKKL--PKKYINTMLEFGLHGNLPACMYKDAVSYDINNIRFLPYNCVMVKDLINVIK 78 
21492495    2 SPSYIYPKRARDALSKIISSSITIERFlhSNVFIDTILEFGFHGILPVSLYSRAIDFDINNLKYFPVESIRLDDLINLLL 81 
9627574     1 --MFMYPEFARKALSKLISKKLNIEKV--SSKHQLVLLDYGLHGLLPKSLYLEAINSDILNVRFFPPEIINVTDIVKALQ 76 
12085025    1 MTLYMYPKNARKALSKLISKKLIIDKV--SKKHIKSLLDYGIHGLLPESVYDYAIRVDIKNIRFFQPNVVRITDLIKVLK 78 
9633845     1 MASYMYPRRARKALGEIISKKLNIEKV--SKKHVSAILEFGFHENLPTCFYNEATAFDINNLKFLPSECIKLNDLRELIA 78 
148912919  82 ESNTIDSKLHNAVFVYRKDLITSrnGDRLIKLMIENDLLNIDDINYIVSESIVPNSYILKLNPMLVSNAMILSKDELIEV 161
157939664  79 TSSVIDTKLYNAIIVNKKKLLES--GIHIIKLIVNSDLITKDDIDWMLENKIIGLTSLLKIKPSLASKQMNLSKEEIIDI 156
62637427   77 KTSSIDTKLYNHVLKHRKTLINH--GIKFIKLMIYNNLLTRDDINFIISKKILTATQILKIDPMIASTNMILSKEDIIEL 154
15150481   82 ESNTIDSKLHNAVLTYRKDLITSrnGDKLIKLMIENDLLNIDDINYIVSECIVPNSYILKLNPMLVSNAMILSKDELIEV 161
17974973   77 NSCRVDEYLKAVSLYHKNSLMVS--GPNVVKLMIEYNLLTHSDLEWLINENVVKATYLLKINAYMINFKIDLTVDEIIDL 154
18640124   79 SSSVIDTRLHQSVLKHRRALIDYg-DQDIITLMIINKLLSIDDISYILDKKIIHVTKILKIDPTVANSNMKLNKIELVDV 157
21492495   82 ESNTIDSKLHNAVLVYRKDLITSrnGDKLIKLMIENDLLNIDDINYIVSECIVPNSYILKLNPMLVSNAMILSKDELIEV 161
9627574    77 NSCRVDEYLKAVSLYHKNSLMVS--GPNVVKLMIEYNLLTHSDLEWLINENVIKATYLLKINAYMINFKIDLTVDEIIDL 154
12085025   79 TSSVIDTKLYNAIIVNKKKLLES--GIHIIKLIVNSDLITKDDIDWMLENKIIGLTSLLKIKPSLASKQMNLSKEEIIDI 156
9633845    79 RSNFIDTRLYNAVLLYRKELMVD--GLNPIKLMIVHGLLTNEDAEYIIENKILTPMQLLKMDPSLATKRMSICKDDLVKI 156
148912919 162 IKFTPSYTWKYLYKHL-SIELDTLLYISDTLNVPPTNISLLKLNNMKKAIEIIKKYPNDDIINYVSSDIKLNLPFIEKIH 240
157939664 157 VKNIPSYNLPYLYDNI-LMDLDTVIYLSDEFNIPPLNYALFKLASISKALELVKKYPEENIVDYLPNAIKKEKRFLENVN 235
62637427  155 IKSVPSYSIPYLYDNL-SIDLKTLLYLSDTFNIAPTNESLLKLNDCVKAIELIKKYPEKNIINYISKNIKNNKCFIEKIH 233
15150481  162 IKFTPSYTWKYLYKHL-SIELDTLLYISDTLNVPPTNISLLKLNNMKKAIEIIKKYPNDDIITYVSSDIKLNLPFIEKIH 240
17974973  155 VKDIPVGATLHLYNILnNIDLDIILRISDEYNIPPVHDILSKLTDEEMCIKLVTKYPMDNVINFINQDVRYSPTFIKTIK 234
18640124  158 ITSIPKSSYTYLYNNM-IIDLDTLLYLSDAFHIPPTHISLRSLRDINRIIELLKKYPNNNIIDYISDSIKSNSSFIHILH 236
21492495  162 IKFTPSYTWKYLYKHL-SIELDTLLYISDTLNVAPTNISLLKLNNMKKAIEIIKKYPNDDIITYVSSDIKLNLPFIEKIH 240
9627574   155 VKDIPVGATLHLYNILnNLDLNIILRISDEYNIPPVHDILSKLTDEEMCIKLVTKYPMENVINFINQDVRYSPTFIKTIK 234
12085025  157 VKNIPSYNLPYLYDNI-LMDLDTVIYLSDEFNIPPLNYALFKLASISKALELVKKYPEENIVDYLPNAIKKEKRFLENVN 235
9633845   157 VTHIPSHAVPGLYNNL-TIDLDTLLYMSDVFDVAPTNDGLFALTDTEKAIELVKKYPNNNVITYLPDAVKHTSVFIQSMH 235
148912919 241 EIVNNNFPKMLTHMNNFLFSTVSKEELIKRYGIKSVAMFS-FNLELHPETISDDDKNFILENINIYESKCKNF-FDFKKK 318
157939664 236 EIVLSFFPNMITSINKLLLSEYSKDYLIKKYGVRSVAMFNfVNLEIKMDDLTQTEKEFIEKNIIYYDTNCRDFaIKFRNI 315
62637427  234 EIVKENLPMLLSGLNRFLYLSVPKSVLVSMYGIKCIAMFS-LDVMTDIKYISDEDKKFIEINISLYDLRCKEFaTVFRDH 312
15150481  241 EIVNDNFPRMLTHMNDFLFSTVSKEELIKRYGIKSVAMFS-FNLELHPETISDDDKNFILENINIYESKCKNF-FDFKKK 318
17974973  235 DFVNEHLPTMYDGLNDYLHSVIIDEDLIEEYKIKSVAMFN-LEYKTDIDTLTLDEQIFVEVNISYYDFRYRQFaDEFRDY 313
18640124  237 MIISNMFPAIIPSVNDFISTVVDKDRLINMYGIKCVAMFSyDINMIDLESLDDSDYIFIEKNISIYDVKCRDFaNMIRDK 316
21492495  241 EIVNDNFPRMLTHMNDFLLSTVSKEELIKRYGIKSVAMFS-FNLELHPETISDDDKNFILENINIYESKCKNF-FDFKKK 318
9627574   235 DFVNAHLPTMYDGLNDYLHSVIVDKDLIEEYKIKSVAMFN-LEYKTDVDTLTLDEQIFVEVNISYYDFRYRQFaNEFRDY 313
12085025  236 EIVVSFFPNMITSINKLLLSEYSKDYLIKKYGVRSVAMFNfINLEIKIDDLTQTEKQFIEKNIIYYDTNCREFaIKFRNT 315
9633845   236 ELVVFHFPNMLTAVNNFIYTVTPEKELIKEYGVKCFAMFPiRPYADALCVKNEEDSAFIETNISLYDSRCRVFaNEFREM 315
148912919 319 FFYNQLKLY---KPPSIi--KSPSFKK---NNNIDDEEKTIDDVLNYIDNL---KRKILITEVEFLISPFKFNPCIVRNI 387
157939664 316 IMNNENRVItmnANKPI---QKIMKISssiRKSIVVEKNSIEEILIHIDNAr-tSQKLSKNNIESLLYPFRLNPCVVRNV 391
62637427  313 IMKTESRVItvnPENII---KKSCILKkpvRHLKVNEENGIEGILIHIDNAl-aKTKLSLSEIKNILANFRLNPCSVRNV 388
15150481  319 IFYNQLKLY---KPPSIi--KSPSFKK---NNNIDDEEKTIDDVLNYIDNS---KRKILITEVEFLISPFKFNPCIVRNI 387
17974973  314 IMIKERRQItmqSGDRIrrfRRPMSLR---STIIKKDTDSLEDILSHIDNAk-kNSKVSIEDVERIISSFRLNPCVVRRT 389
18640124  317 VKREKNRILttkCEDIIr------YIKlfsKNRINDENNKVEEVLIHIDNVs-kNNKLSLSDISSLMDQFRLNPCTIRNI 389
21492495  319 FFYNQLKLY---KPTSIi--KSPSFKK---KNNIDDEEKTIDDVLNYIDNL---KRKILITEVEFLISPFKFNPCIVRNI 387
9627574   314 IMLKESRQItmqTGDKIrrfRRPMSLR---STIIKKDTDSLEDILSHIDNAr-kNSKVSIEDVDRIISSFRLNPCVVRRT 389
12085025  316 IMNNENRVItmnANKPI---QKIMKISssiRKSIVVEKNSIEEILIHIDNAr-tSQKLSKNNIESLLYPFRLNPCVVRNV 391
9633845   316 IKHKQNRTIppsRPGWVlnqKQSCKLRcsmKKCTKHEENDVEEVLMHIDNLmldKHKIDYECINSLISPFKLDPRIVRNI 395
148912919 388 CLSNSSIKTKLLLLKIIKKWKysynltNKFLFGIQSFKK-INDIITFDMTNYIISVILCKYKKIYDRIKKLENLVNMnLI 466
157939664 392 LLSNSKTKTKIIALKVIKNWK------SQSITPTSTFYK-TKGVIIMDMMDYIATKVLHNYVVIFDKFKKLENGPSV-LS 463
62637427  389 LLSNVSTKTKIAALKAIKQWK------SQTLTYTTTYQKmNKTVIIMDMLDSISTKILNNHANIFYKLKNFEKMAKM-PL 461
15150481  388 CLSNSSIKTKLLLLKIIKKWKysynltNKFLFGIQSFKK-INDIITFDMTNYITSVILCKYKKIYDRIKTLENLVNMnLI 466
17974973  390 MLSDIDIKTKIMVLKIAKDWK------SCTLTLS------VKGIMVTDTINTVLSKILHHHRNVFKYLTSVENKEIA--V 455
18640124  390 LLSSATIKSKLLALRAVKNWK------CYSLTNVSMYKK-IKGVIVMDMVDYISTNILKYHKQLYDKMSTFEYKRDI-KS 461
21492495  388 CLSNSSIKTKLLLLKIIKKWKysynltNKFLFGIQSFKK-INDIITFDMTNYITSVILRKYKKIYDRIKTLENLVNMnLI 466
9627574   390 MLSNIDIKTKIMVLKIAKDWK------SCALTLSA-----IKGIMVTDTINTVLSKILHHHRNVFKYLTSVDNKEIT--V 456
12085025  392 LLSNSKTKTKIIALKVIKNWK------SQSITPTSTFYK-TKGVIIMDMMDYIATKVLHNYVVIFDKFKKLENGPSV-LS 463
9633845   396 IRSGVGIKTKLITLKIIKSWK------SYTCANICSFRK-IKGVIIMDTMDHIVAKLLRYYKQAYDVLESRAKMSLA--R 466
148912919 467 CNCENCNNSKIN-H-KSKNTYLSKKTSDDDIINCLYDLVNYAIHGLVNPSLIGIKGWGALSCLLNGTKKnkIDINIYNTM 544
157939664 464 CKCYKCKNEENN-L-KSKNIVLSKNSSDDDLINCLHDLVRYAVHGYVNPSIIKFSGWGPLIGFISGNRKi-KNDMFIKIM 540
62637427  462 CNCLKCSTASYN-IiKSNDVTIHERSNDDDLIKCLYDLVRYAIHGMVNPNIIGKRGWGPLISLLSDDVMk-IKLNISDIT 539
15150481  467 CNCENCNNSKIN-H-KSKNIYLGKKTSDDDIINCLYDLVNYAIHGLVNPSLIGIKGWGALICLLNGTKKnkIDINIYNTM 544
17974973  456 CNCSRCLSL----FyRKLKSVRCDLRTDDGLLDRLYDLTRYALHGKINQNLIGQRCWGPLTEILFNENK---KKKLNNLM 528
18640124  462 CKCSICSDSITH-HiYETTSCINYKSTDNDLMIVLFNLTRYLMHGMIHPNLISVKGWGPLIGLLTGDIG--INLKLYSTM 538
21492495  467 CNCENCNNSKIN-H-KSKNIYLGKKTSDDDIINCLYDLVNYAIHGLVNPSLIGINGWGALICLLNGTKKnkIDINVYNTM 544
9627574   457 CNCSRCVSL----FyRELKSIRCDLNTDDGLLARLYDLTRYALHGRINQNLIGQRCWGPLTEMLFNEDK---KRKLNNLM 529
12085025  464 CKCYKCKNEEIN-L-KSKNILLSKNSSDDDLINCLHDLVRYAVHGYVNPSIINFSGWGPLIGFISGNRKi-KNDMFIKIM 540
9633845   467 CRCKNCSFVFIEgMfKSKNLTIHERSSDDDLTACVFDLVRYAVHGMINPTILDVSDWGLLSGLYSGSRT--IKTNLYSMM 544
148912919 545 DFNFvSNNGDILLSGSYLVNKLIPITKTPLSSFVPF-TCFSLNDYFSKTVILFNIILEYMISFVLYRIITIQRYNNLKEY 623
157939664 541 ENDN-LIDSSVNFSGINLVSKLVYITSVSLESIIGN-KIFPLNDSYAKVVILLNVILEYMFVILMYRLIVNQRFTGVREF 618
62637427  540 ESENfLFMGDIILSGNNLVNKLIPIVSTSVNNLTST-ICFPLNESYAKVVLLLNIIIEYMFSILLYRIVIIQRFRNNREF 618
15150481  545 DFNFvSTNGDILLSGSYLVNKLIPITKTPLSSFVPF-TCFSLNDYFSKTVILFNIILEYMTSFVLYRIITIQRYNNLKEY 623
17974973  529 EY---IKISDMLVYGHYIEKTLIPITDSLSFKLFVD-TMSVLNDQYAKVVIFFNTIIEYIIATIYYRLTVLDNYTNVKHF 604
18640124  539 NING-LRYGDITLSSYDMSNKLVSIINTPIYELIPFtTCCSLNEYYSKIVILINVILEYMISIILYRILIVKRFNNIKEF 617
21492495  545 DFNFvSTNGDILLSGSYLVNKLIPITKTPLSSFVPF-TCFSLNDNFSKTVILFNIILEYMTSFVLYRIITIQRYNNLKEF 623
9627574   530 VY---IKISDMLVYGHSIEKTLIPITESLSFKLSVD-TMSVSNDQYAKVVIFFNTIIEYIVATIYYRLAVLNNYVAIRHF 605
12085025  541 ENDN-LIDSSVNFSGINLVSKLVYITSVSLESIIGN-KIFPLNDSYAKVVILLNVILEYMFVILMYRLIVNQRFTGVREF 618
9633845   545 DLEN-LNTCDVILTGTNMGQKLVSVTATPLRKLLPF-CYFPLNEYYVKVISVLNIITEYIMAFILYRLVIIQRLTNIKTF 622
148912919 624 ISKVVNTCLEASGVFFKQINISNIIETEINDIVINGSFPVRLLNIFLKVITTILEEINGIS 684
157939664 619 VSKIVNKTLESSGVYFCQIKTNENINIEIDELLSNGSTPVYLIHLFLKVVSIILEEINGSN 679
62637427  619 ISKIINSVFEGCGIYFCQLRVNENIDIEIDELIVKGSLPVHLIHLFLKVILIIFEDLNGTD 679
15150481  624 ISKVVNTCLEASGVFFAQINISNIIETEINEIVINGSFPVRLLNIFLKVITTILEEINGIS 684
17974973  605 VSKVLHTVMEACGVLFSHIKVNDKIEYELEEMVDKGTVPSYLYHLSINVISIILDDINGTR 665
18640124  618 ISKVVNTVLESSGIYFCQMRVHEQIELEIDELIINGSMPVQLMHLLLKVASIILEEIKEI- 677
21492495  624 ISKVVNTCLEASGVFFTQINISNIIETEINEIVINGSFPVRLLNIFLKVITTILEEINGIS 684
9627574   606 VLKVLHTVMEACGVLFSHIKVNDKIEHELEEMVDKGIVPSYLHHLSINVISIILDDINGTR 666
12085025  619 VSKIVNKTLESSGVYFCQIKTNENINIEIDELLSNGSTPVYLIHLFLKVVSIILEEINGSN 679
9633845   623 LYKITNVALEAAGVNFCHLKVHDNIETEIDELITQGTMPVHVTHLILKVVIVIFDELIR-- 681
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap