Conserved Protein Domain Family
PHA03000

?
PHA03000: PHA03000 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177505
View PSSM: PHA03000
Aligned: 25 rows
Threshold Bit Score: 859.71
Threshold Setting Gi: 115531720
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556061    1 MDFIRRKYLIYTVENDIDFFRQELLDKISSFSLNHVLAINYIIKKYHKSVLTKEVFDNANFYVFLHFIRDCETYDLVLKS 80 
157939659   1 MDYIRRKYLIYTIENKIDFLKDEVFNKVSNFSLNHVLALKYLIINFSNDVINKDVLNNPNFFVFLHMVKCNQVYDTVLNQ 80 
38229200    1 MDYIRRKYLIYTIENKVDFLKDEFFTKISNFSLNHVLALKYLIINFSKDVINKDVLSNPNFFVFIHMVKCEKVYDAILNK 80 
41057458    1 MDFIRRKYMIHAIDRNLDFMRAEFQQKVSIFSLGHVLALHYLVTTFPHAVVTKDVLASTNFFVFVHMSQRCEVFDAVLRA 80 
41057085    1 MDFVRRKYMIHAIDRNLDFMKAEVQQKVSIFSLGHVLALHYLVTAFPQAVITKDVLASTNFFVFVHMSQRHEVFDAVLKA 80 
9628969     1 MDFIRRKYLVHTIERNMDFLRAEVAEKVANFALNHVLALRYLVAQFPRAVLTKDVFANVNFHVFLHVVRCAQVYDAVLRS 80 
12085020    1 MDYIRRKYLIYTIENKIDFLKDEVFNKVSNFSLNHVLALKYLIINFSNDVINKDVLNNPNFFVFLHMVKCNQVYDTVLNQ 80 
9633668     1 MDFIRRKYLIYTIDNRIDFLRDEMISKVSNFNLNNVLAIKYLVINFCKDVVSKDVLTNPNFFVFLHIVKCKDVYNELLCC 80 
9633841     1 MDFIRRKYLIYTIDNKIDFLRDEMISKVSNFNLNNVLAIKYLVINFCKDVVSKDVLTNPNFFVFLHIVRCKDVYNELLCH 80 
9634766     1 MDFIRRKYLIYTVENNINFFTQELADKISNFCLNHVVAINYIIKKYHKSVLTKDIFNNTNFYIFLHFIRDCETYDIVLKS 80 
40556061   81 SFDVTLLYIKQLIKNYNVFTEYISNYKKYANSLLDDERFKFVAKLSPYFHDIIGINFNTEINPLFHLNEPIKDLEIIYTK 160
157939659  81 SFDLPTLYVKSLIKNYSLFYNFIQTYKTLVQDLIFNKKFIEVVSYIDTFKDVIGVNYDLNLNPLFYNGEPIRNMEIIYDK 160
38229200   81 SFDMPTLYIKSLIKNYSLFYSFIQTYKTLVQKLVFDKKFIEVVSYIDTLKDAIGVNYDLTLNPLFYNGEPIRNMELIYDK 160
41057458   81 AFDAPQLFVRALSRNFEAFSSAIQAYRTACAALLQDARFMEVAARSAELAEVIGVNYDLASNPLFADGEPIRDMELVFAR 160
41057085   81 AFDAPQLFVRALSRHFEAFAAAIQAYRATCAELLADARFMEVAARAAELAEVIGVNHDIAANPLFADGEPVRDAELIFAK 160
9628969    81 SFDATTLYVRALVRNYQAFADTVQTYRELCQTLLQDKRFLEVARAAPTLADVIGVNYDTSLNPLFLRGEPVRDMELIFTK 160
12085020   81 SFDLPTLYVKSLIKNYSLFYNFIQTYKTLVQDLIFNKKFIEVVSYIDTFKDVIGVNYDLNLNPLFYNGEPIRNMEIIYDK 160
9633668    81 VFDAPTLYIKALVKHYALFSDVIETYKKTVQELMFDDRFTEVARHATRFGDIIGVNYDLALNPLFHYGEPIKNMDIVYGK 160
9633841    81 VFDAPTLYIKALIKYYSLFSDAIEAYKKPVQELMFDDRFTEITRHAHKVYNFIGVNYAFALNPLFHYGDLIKNMDIVYGK 160
9634766    81 SFDVTLLYLNQLVKNYTSFTDFIDIYKQQSNTLLDDKRFLFVTKLSPYFQDIISVNFSTELNPLFHLNEPIKDLEIIYSK 160
40556061  161 LFKETIFMKVDKIEVLRLLIWLYSLKMDTGMMFEDNDDQDLYTILQKTGP-VVNGIVTETFKEFIFPNStTTSYWLFMKE 239
157939659 161 LFKKTDFKAVEKLSVIRLLIWAYLTKQDTGLIFEDNDSQDIYTLLQKSGQ-IINSEMTEKFKEYIFPGNnKTSYWIWLKE 239
38229200  161 LFKKTEFKSVDRLSVIRLLIWAYLTKQDTGLTFEDNDSQDVYTLLQKSGQ-VINSEMTEKFKEYIFPGNdKTSYWIWLKE 239
41057458  161 LFRKTEFRAVKRLAVLRLLVWAFLVKRDVGGEYADNDRQDLFTLLQKAGP-VRHSGLTESIREYMFPGD-KPSYWVWLNA 238
41057085  161 TFRKTEFRAVKRLAVLRLLVWAFLVKKDLGGEYADNDRQDLFTLLQKAAGpVRHSALTESIREYLFPGD-RPSHWVWLNA 239
9628969   161 LFRKTEFRPVKKLAVLRLLLWAYLCKQDTGLDFADNDAQDLYSLFQKTGP-VVHSEMTERFKAFMFAGE-KTSYWVWLQE 238
12085020  161 LFKKTDFKAVEKLSVIRLLIWAYLSKQDTGLIFEDNDSQDIYTLLQKSGQ-IINSEMTEKFKEYIFPGNnKTSYWIWLKE 239
9633668   161 LFKKSDFKRVKKMEVFRLMIWAYLSKQDTGIEFSDNDSQDIYTLFQTSDN-VIHSDMTEKFKEYIFGGN-RSSRWIWLNE 238
9633841   161 LFKKSDFKRVKKMEVFRLMIWPYLSKLDTGMEFSDNDSQDIYTLFQKSDN-IIHSDMTEKFKEYIFGVN-RSSRWIWLNE 238
9634766   161 LFKETRFIKVDRISVLRLLIWAYSLKMDTGMKFDDNDSHDLYTILQKTGP-VVSSIMTETFKEFVFPKNsTTSYWLFMKE 239
40556061  240 RIYDDKKIYSSDPAVTMYEKVLSYIYSEIKQGRVNKNMLKVIYIMDRDSDIKKIMLELVYGIPGDIISIIDEKDETWRSY 319
157939659 240 NIFNDNKIFKKYLSTTMYDKILSFIYLELKQGKVNKNMLKLVYTFEEDEYIKSVFLQIIYGVPGDILSIIDSYDEAWKKY 319
38229200  240 NIFNDNKILKKHISTTMCDKILSFIYSELKQGKVNKNMLKLVYTFEEDEYMKSIFLQIIYNVPGDILSIIDSYDDSWKKY 319
41057458  239 RVTSDADVYRDRNARTLYERVLSYAYSEVKQGRVNANTLKLVYRLEDDTDIRGLLLQLIYDVPGDILGVVDSADEEWRQY 318
41057085  240 RVADDAEVYRDRPARTLYERVLSYAYSEVKQGRVNTNTLKLVYRLEDDPDIKGLLLQLIYDVPADIVGVVDSANEEWRSY 319
9628969   239 PVANDADVFKERPARGMYERLLSYLYSELKQGRVNKNMLKLVYIFDSDPSIRSLVLEIIYGVPGDILGVVDSEDETWKAY 318
12085020  240 NIFNDNKIFKKYLSTTMYDKILSFIYLELKQGKVNKNMLKLVYTFEEDEYIKSVFLQIIYGVPGDILSIIDSYDEAWKKY 319
9633668   239 PIANDADIYLDGFAVSMYDKVLSYVYSELKQGRVNKNMLKLVYIFETDEYIQSVLLQIIYDVPGDILSIIEAKDDAWKKY 318
9633841   239 PIANDVDIYLDGVATSMYDKVLSYVYSELKQGRVNKNMLKLVYIFETDAYMQSVLLQIIYDVPGDILSIIESKDEAWKKY 318
9634766   240 RIYNDEKVYTNEPAITIYEKVLSYIYSEIKQARVNKNMLKVVYMLDSDSEIKKFMLELIYGIPGDILSIIDERDETWKSY 319
40556061  320 FVDFYRNKFIDNKTFTDTTRFYDDLFTIVASIDPKNFSVKRdLEAIFRTDATTVKRFDEMKINSTYVSQMIYQNQNIDLL 399
157939659 320 FIGMYKDQFIDGNTFLSSRTFNDDLFKVVAKIDPEYFDIDK-IISVFDHKPEQINFFNSIDINKTYLSNIIYDLKDVNFS 398
38229200  320 FIGMYKEQFIDGNTFLSSRTFNDDLFKVVAKIDPEYFNVDK-IMSIFDHKPENIKFFNDIDINKTYISNIVYDSKDINFS 398
41057458  319 FVRLYRENFVDGKTFTADARFRDDLFRVVAAVDPDFFEPAR-IREAFGADARLRERFADMDLNGAFMSHLVYGTADPDLH 397
41057085  320 FVSLYRENFVDGRTFTSDARFRDDLFRVVAAVEPDFFEPER-IREAFSADARLRERFTDMDLNNAFMSHLIYDSVDPDVA 398
9628969   319 FVALYREHFVDGRTFTSTQSFFRDLFRVVARVDPEHFGAER-FAALFNAQPEARARFDDMDVNTTFVSRMVYQTPDLDLL 397
12085020  320 FIGMYKDQFIDGNTFLSSRTFNDDLFKVVAKIDPEYFDINK-IISVFDHKPEQINFFNSIDINKTYISNIIYDLKDVNFS 398
9633668   319 FIGLYKEHFIDGKTFNSTRTFNSDLFNVVAKISPSYFDPEK-VISAFDHPPDKVKFFDKMDINDTYISNIVYETKELNIS 397
9633841   319 FIGLYKEHFIDGKTFNSTRTFNSDLFNVVAKISPSYFDPEK-VISVFDHPPDKVKFFDKMDINDTYISNIVYETKELNIS 397
9634766   320 FVDFYHDNFIDDKTFTSANRFYDDLFNVIAKIDPEKFDIRRdIESIFRTDATLVKRFDDMKINSTYVSQMIYQTQNVDLL 399
40556061  400 ALENKKICQIYNEDTEYSIREYNTYLYLNEEDPIIINKGRLVKLSDLDLtSPAvvFSLFSRSILKYYLDSNLAKIGLIID 479
157939659 399 NINNLKSCQIYNDDTKYYIKEYNTYLYLNEDDPLILNNGILTKYSTIQP-NKR--ISLLSKNILKYYIDSNLANIGLVLC 475
38229200  399 SIDNLKTCQIYNDETKYFIKEYNTYLYLNEEDPLILNNGILTKYSTIPS-TKR--ARLLSKNILRYYVDSNLANIGLVLC 475
41057458  398 AAERGLGMRLYNEDSEFFIREYNTYLFLTEDDPLVLDRGALSKLSDVPR-ERH--RELFSDSVLRYFLDAKLGTLGLVLE 474
41057085  399 AAERGLSLRVHNEDSDYFIREYNTYLFLSEKDPLVLDRGALTRLSDVPA-ERF--RDLFSDSVLRYFLDAKLGTLGLVLE 475
9628969   398 ALERNRMCQIYSEDTQYYVKEYNTFLFLHEDDPVVIDEGALVRLSSVPS-ERR--RLLFSEHVLKYWLDGQLARLGLVLP 474
12085020  399 NINNLKSCQIYNDDTKYYIKEYNTYLYLNEDDPLILNNGILTKYSTIQP-NKR--ISLLSKNILKYYIDSNLANIGLVLC 475
9633668   398 TIEESQKCQIYNQETSYYIKEYNTYMYLHEEDPYVLHKGMFVKLSTVPQ-DKK--FSLFSDHILKYYIDGKLARIGLVVT 474
9633841   398 TIEESQKCQIYNQETSYYIKEYNTYMYLHEEDPYVLYKGMFVKLSSVPE-DKK--FSLFSDHILKYYIDGKLASIGLVVN 474
9634766   400 ALENKKLCQIYNKDTEYAIKEYNTYLYLNEDNPIVIYKGELKKLSDLDLnSPSivFSLFSKSLLKYYLDSKLASLGLIIE 479
40556061  480 NYKDDIILKLITNASCLENFTNFVVYATCNDKSILKSVIRSIINNFNVAILLLFKHFLRENMYYVSEYLTSNKHLSKNEK 559
157939659 476 NYDGDIIVKIISHLKCIEDVTTFIRFATCKNDSILPSIIKTILANFNVSIIILFQKFLQENIYHVELFLDKSNHFTNNDK 555
38229200  476 NYSGDIIVKILSHLKCIEDVTTFIRFATCKNNSILPSIIKTILANFNVSVIILFQNFLQENIYHVELFLDKSTHFTYNDK 555
41057458  475 DYSDDVVASMLRHLRRVEDVSSFVTHAARRNAAAVPGIVRAVVSNFNPAVVAAMRPFLRENLTRVEALLDGLAHLTPADK 554
41057085  476 DYREDVVAAMLRHLRRVEDVSSFVAYAARKNPACVPGVVRAVVSNFNPAVVAAMRPFLREHMTRVDALLDGMPHLSEADR 555
9628969   475 SYD-DVVLRMVTHMKCLEDVTAFVDYATRRNASMVPAVTRGLLAHFHVPVLVLFQRFLREHLLRVREVLDRSEHLTEREK 553
12085020  476 NYDGDIIVKIISHLKCIEDVTTFIRFATCKNDSILPSIIKTILANFNVSIIILFQKFLQENIYHVELFLDKSNHFTNNDK 555
9633668   475 DYK-DVLVDILSHLKCVEDVTTFVRFSVCKNSSVISSVVRTILGNFNTSVIVLFQKFLRDNMYYVELFLDNTNHLTENDK 553
9633841   475 DYK-DVLVHILSHLKCVEDVTTFVKFSVCKNSSVTSSVVRTILGNFNTSVIVLFRKFLRDNMYYVELFLDNTNHLTMNDK 553
9634766   480 NYKDDIILKIITGSSCLQNFTSFIVYATCNDKSILKSVVRTIINHFKVAIIILFKQFLQENIYYVNEYLDNTKHLSKNDK 559
40556061  560 KYILQIINGNID 571
157939659 556 KYLLKLIKEGRS 567
38229200  556 KYLLKLIKEGRS 567
41057458  555 QYIRRVILQGRS 566
41057085  556 RYIRRVVLQGRA 567
9628969   554 KYILQIITHGRS 565
12085020  556 KYLLKLIKEGRS 567
9633668   554 KYLLNVIKHGRT 565
9633841   554 KYLLNVIKHGRT 565
9634766   560 KFILQIINGNYD 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap